DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and bmp7.1

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_989197.1 Gene:bmp7.1 / 394805 XenbaseID:XB-GENE-486014 Length:424 Species:Xenopus tropicalis


Alignment Length:437 Identity:130/437 - (29%)
Similarity:205/437 - (46%) Gaps:62/437 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSE-----QMEMIDILDLGDRPRRQAEPNL 60
            :|..:||..:..|.     .|.:|.:.....|:|...:     |.|::.||.|..|||    |:|
 Frog    13 LLWTYFLWRIILAD-----FTLDNEVHSSFIQRRLRGQERREMQREILSILGLPHRPR----PHL 68

  Fly    61 H---NSASKFLLEVYNEISEDQEPKEVLHQRHKR--SLDDDILISNEDRQEIASCNSILTFSSRL 120
            :   |||..|:|::||.::.|:|..|.....:|.  :.....|.|.:|...:...:.:::|.:.:
 Frog    69 YGKQNSAPMFMLDLYNAMTVDEEEAEGFSYPYKPIFTTQGPPLASQQDSNFLNDADMVMSFVNLV 133

  Fly   121 KPEQLDNELDMH---ITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRAN--FTVSVYRKLDNRQ-- 178
            :.::.......|   ..|:...:|...::..|..||||. .:.:|..|  |.:|||:.|...|  
 Frog   134 EHDKEFFHQRRHHREFRFDIAKIPEGEAVTAAEFRIYKD-YIRERFENETFQISVYQVLQEHQGR 197

  Fly   179 DFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL----HNKGLQRRNELRISIGDSQLSTFAAGLVT 239
            |.....|.|....:::.|||.|::|.|..:|:    ||.|||...|   ||....::...|||:.
 Frog   198 DSDLYELDSRTIWAAEEGWLVFDITTTSNHWVVNPQHNLGLQLSVE---SIDGQSINPKMAGLIG 259

  Fly   240 PQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGG-------SPPPPPPPPVDLYR-- 295
            ....... :||:|.:|...|:           .|...|:.||       |..|.....:.:..  
 Frog   260 TNGPHNK-QPFMVAFFKATEI-----------HLRSIRSAGGKHRNQNRSKAPKSQEALRVSNIA 312

  Fly   296 ------PPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMH 354
                  ..|:|::....|.||:|...:|:|||:.:.|::|.|.|.|||.:.||||||||||||:|
 Frog   313 ENSSTDQKQACKKHELYVSFKDLGWQDWIIAPEGYAAFYCEGECAFPLNSYMNATNHAIVQTLVH 377

  Fly   355 LKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
            ...|. :|||||.||.|..|::|.:.:...:.|.||:..|.:.||||
 Frog   378 FINPDTVPKPCCAPTQLNPISVLYFDDSSNVILKKYRNMVVRACGCH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 65/230 (28%)
TGFB 300..400 CDD:214556 46/100 (46%)
bmp7.1NP_989197.1 TGFb_propeptide 31..273 CDD:366248 68/250 (27%)
TGF_beta_BMP7 318..424 CDD:381667 47/105 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.