DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and INHBC

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_005529.1 Gene:INHBC / 3626 HGNCID:6068 Length:352 Species:Homo sapiens


Alignment Length:386 Identity:91/386 - (23%)
Similarity:141/386 - (36%) Gaps:92/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LSEQMEMIDILDLG-----DRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDD 95
            |..|.|:  :|||.     |:......|.|:...|:..|..              ..:|...:..
Human    36 LESQREL--LLDLAKRSILDKLHLTQRPTLNRPVSRAALRT--------------ALQHLHGVPQ 84

  Fly    96 DILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQ-PSL 159
            ..|:.:...||   | .|::|:...........||.|  |:::....|..:.||.|..:.| || 
Human    85 GALLEDNREQE---C-EIISFAETGLSTINQTRLDFH--FSSDRTAGDREVQQASLMFFVQLPS- 142

  Fly   160 VDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL-------HNKGLQR 217
               ...:|:.| |.|         :||..||          |||...:|.|       |...|..
Human   143 ---NTTWTLKV-RVL---------VLGPHNT----------NLTLATQYLLEVDASGWHQLPLGP 184

  Fly   218 RNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKR--RAGG 280
            ..:...|.|...|.....|    |.:::|:  .:.|..:.|.:..:: ::..|..:.:|  ...|
Human   185 EAQAACSQGHLTLELVLEG----QVAQSSV--ILGGAAHRPFVAARV-RVGGKHQIHRRGIDCQG 242

  Fly   281 GSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK----M 341
            ||               :.|.|..|.|||:|:..|:|:|.|:.:...||.|.|  ||...    :
Human   243 GS---------------RMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC--PLHIAGMPGI 290

  Fly   342 NATNHAIVQTLMHLKQPHLPK---PCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            .|:.|..|..|:.........   .|||||....:::|.|..:..|..|.....|.:.|||
Human   291 AASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 49/227 (22%)
TGFB 300..400 CDD:214556 34/107 (32%)
INHBCNP_005529.1 TGFB 247..352 CDD:214556 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.