DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and INHBA

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_016867663.1 Gene:INHBA / 3624 HGNCID:6066 Length:548 Species:Homo sapiens


Alignment Length:414 Identity:93/414 - (22%)
Similarity:168/414 - (40%) Gaps:98/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DRPRRQAEPNLHNSASKFLLEVYN-----EISEDQEPKEVLHQRHKR------------SLDDDI 97
            |.|..|  |.:..:..|.:|.:.:     :::: ..||..|....::            .::|||
Human   168 DVPNSQ--PEMVEAVKKHILNMLHLKKRPDVTQ-PVPKAALLNAIRKLHVGKVGENGYVEIEDDI 229

  Fly    98 LISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQ-AMLRIY-KQPSLV 160
            ....|..:.:...:.|:||:     |.......:|  |..:....|||:|: |.:.:: |.|...
Human   230 GRRAEMNELMEQTSEIITFA-----ESGTARKTLH--FEISKEGSDLSVVERAEVWLFLKVPKAN 287

  Fly   161 DRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRIS- 224
            ..|...|:.::::..:.|       ||::|.....   |..|          ||  .|:||.:| 
Human   288 RTRTKVTIRLFQQQKHPQ-------GSLDTGEEAE---EVGL----------KG--ERSELLLSE 330

  Fly   225 -IGDSQLSTFAAGLVTPQASR------TSLEPFIV---GYFNGPELLVKIQKLRFKRDLEKRRAG 279
             :.|::.||:....|:....|      :||:..|.   ...:|..|::..:|.:.:.:.|.::.|
Human   331 KVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKG 395

  Fly   280 GG-------SPPPPPPPPVDLYRPPQS--------------------CERLNFTVDFKELHMHNW 317
            ||       ........|..:.:..||                    |.:..|.|.||::..::|
Human   396 GGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDW 460

  Fly   318 VIAPKKFEAYFCGGGC-NFPLGTKMNATN-HAIVQTLMHLK-QPHLP----KPCCVPTVLGAITI 375
            :|||..:.|.:|.|.| :...||..::.: |:.|  :.|.: :.|.|    |.|||||.|..:::
Human   461 IIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTV--INHYRMRGHSPFANLKSCCVPTKLRPMSM 523

  Fly   376 LRYLNEDIIDLTKYQKAVAKECGC 399
            |.|.:...|.....|..:.:||||
Human   524 LYYDDGQNIIKKDIQNMIVEECGC 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 48/233 (21%)
TGFB 300..400 CDD:214556 35/107 (33%)
INHBAXP_016867663.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.