DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and BMP8A

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_861525.2 Gene:BMP8A / 353500 HGNCID:21650 Length:402 Species:Homo sapiens


Alignment Length:390 Identity:121/390 - (31%)
Similarity:193/390 - (49%) Gaps:60/390 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QMEMIDILDLGDRPRRQAEP---NLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS 100
            |.|::.:|.|..|||.:|.|   .|..||..|:|::|                |..:.|||    
Human    45 QREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDLY----------------HAMAGDDD---- 89

  Fly   101 NED----RQEIASCNSILTFSSRLKPEQLDNELDMH---ITFNTNDVPVDLSLVQAMLRIYKQPS 158
             ||    .|.:...:.:::|.:.::.::.....:.|   ..|:...:|...::..|..||||.||
Human    90 -EDGAPAEQRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPS 153

  Fly   159 --LVDRRANFTV-SVYRKLDNRQ-DFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRN 219
              |::|..:.:: .|.::..||: |..:..|.::.  :...|||..::|.....||    |:|..
Human   154 IHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLR--AGDEGWLVLDVTAASDCWL----LKRHK 212

  Fly   220 ELRISI------GDSQLSTFAAGLVTPQASRTSLEPFIVGYFN-GPELLVKIQKLRFKRDLEKRR 277
            :|.:.:      |.| :....|||:..:|.| |.:||:|.:|. .|.   .|:..|..|.|.:|:
Human   213 DLGLRLYVETEDGHS-VDPGLAGLLGQRAPR-SQQPFVVTFFRASPS---PIRTPRAVRPLRRRQ 272

  Fly   278 AGGGSPPPPP---PPPVDLYRPP---QSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFP 336
            ....:..|..   |...|..|..   |.|.|....|.|::|...:|||||:.:.||:|.|.|:||
Human   273 PKKSNELPQANRLPGIFDDVRGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFP 337

  Fly   337 LGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
            |.:.||||||||:|:|:||.:|: :||.||.||.|.|.::|.|.:.:.:.|.|::..|.|.||||
Human   338 LDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH 402

  Fly   401  400
            Human   403  402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 60/234 (26%)
TGFB 300..400 CDD:214556 47/100 (47%)
BMP8ANP_861525.2 TGFb_propeptide 33..251 CDD:279078 60/234 (26%)
TGF_beta 299..401 CDD:278448 47/101 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.