DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and ndr2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_624359.1 Gene:ndr2 / 30292 ZFINID:ZDB-GENE-990415-181 Length:501 Species:Danio rerio


Alignment Length:142 Identity:50/142 - (35%)
Similarity:79/142 - (55%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 RFKRDLEKRRA-----GGGSPPPPPPPPVDLYRPP----QSCERLNFTVDFKELHMHNWVIAPKK 323
            |.|:::::.||     |...||...|   :|.|.|    .:|.|::..|||.::...:|::.|||
Zfish   363 RNKKEVKRGRALRSRRGRRGPPVRSP---ELQRTPLHKSTTCRRVDMHVDFNQIGWGSWIVFPKK 424

  Fly   324 FEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP-HLPKPCCVPTVLGAITILRYLNEDIIDLT 387
            :.||.|.|.|..|||.::..||||.:|:|:....| .:|..||.||...|:::|.|.|.::| |.
Zfish   425 YNAYRCEGACPNPLGEELRPTNHAYMQSLLKYHHPSRVPASCCAPTRTSALSMLYYENGEMI-LR 488

  Fly   388 KYQKAVAKECGC 399
            .::....:||||
Zfish   489 HHEDMQVEECGC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078
TGFB 300..400 CDD:214556 39/101 (39%)
ndr2NP_624359.1 TGFb_propeptide 44..>174 CDD:279078
DUF1631 <175..>277 CDD:285086
TGF_beta 401..500 CDD:278448 37/99 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.