DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and gdf6b

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_571062.1 Gene:gdf6b / 30180 ZFINID:ZDB-GENE-980526-442 Length:412 Species:Danio rerio


Alignment Length:429 Identity:102/429 - (23%)
Similarity:165/429 - (38%) Gaps:142/429 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNVFFLTSLFYAASATTYVT--TNNHIEMPIYQKR------PLSEQMEMIDILDLGDRPRRQAEP 58
            ||..|..|...|.:.|::|.  .::|:..|:::::      .|||.:|::.           || 
Zfish    94 LNASFFRSSKAANTITSFVDEGQDDHLNSPLWRQKYLFDVSTLSENVEILG-----------AE- 146

  Fly    59 NLHNSASKFLLEVYNEIS-----EDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSS 118
                      |.:|.:||     .:..|.|:                     ::.||.|.....|
Zfish   147 ----------LRIYTKISGSFRASETGPVEI---------------------QLLSCQSHTVLDS 180

  Fly   119 RLKPEQLDNELDMH-ITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQ---D 179
                :.||.| |.| ..:...||          ..|:|:.........|.:.:...|||.:   |
Zfish   181 ----QTLDLE-DAHKPKWEVFDV----------WEIFKERQHHSHGNRFCLELRATLDNPEREID 230

  Fly   180 FSY------------RILGSVNTTSSQRGWLEFNLTDTLRYW-LHNKGLQRRNELRISIGDSQLS 231
            ..|            :.:..|.|.|.:|..|.:...:.::.| |.:.|.:||:..:         
Zfish   231 LQYLGFHRHGRPQLKKAILVVFTRSKKRQSLFYEKREKIKLWGLDSIGKERRSHSK--------- 286

  Fly   232 TFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRP 296
                   |.::.||:| |...|                ||..:|.::                  
Zfish   287 -------TRRSRRTAL-PNRHG----------------KRHGKKSKS------------------ 309

  Fly   297 PQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP-HL 360
              .|.:....|:|:||...:|||||..:|||.|.|.|:|||.:.:..|||||:||||:...| ::
Zfish   310 --RCSKKPLHVNFRELGWDDWVIAPLDYEAYHCEGMCDFPLRSHLEPTNHAIIQTLMNSMNPSNM 372

  Fly   361 PKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            |..||||:.|..|:||.....:.:...:|:..|.:.|||
Zfish   373 PPSCCVPSKLSPISILYIDAGNNVVYKQYEDMVVESCGC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 43/236 (18%)
TGFB 300..400 CDD:214556 43/101 (43%)
gdf6bNP_571062.1 TGFb_propeptide 77..252 CDD:279078 40/215 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..311 11/83 (13%)
TGF_beta 315..411 CDD:278448 40/95 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.