DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Inhba

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_058824.1 Gene:Inhba / 29200 RGDID:62074 Length:424 Species:Rattus norvegicus


Alignment Length:415 Identity:86/415 - (20%)
Similarity:156/415 - (37%) Gaps:102/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DRPRRQAEPNLHNSASKFLLEVYN-----EISEDQEPKEVLHQRHKR------------SLDDDI 97
            |.|..|  |.:..:..|.:|.:.:     :::: ..||..|....::            .::|||
  Rat    46 DGPNSQ--PEMVEAVKKHILNMLHLKKRPDVTQ-PVPKAALLNAIRKLHVGKVGENGYVEIEDDI 107

  Fly    98 LISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQ-AMLRIY-KQPSLV 160
            ....|..:.:...:.|:||:     |.......:|  |..:....|||:|: |.:.:: |.|...
  Rat   108 GRRAEMNELMEQTSEIITFA-----ESGTARKTLH--FEISKEGSDLSVVERAEVWLFLKVPKAN 165

  Fly   161 DRRANFTVSVYRKLDNRQ----------------DFSYRILGSVNTTSSQRGWLEFNLTDTLRYW 209
            ..|...|:.::::..:.|                :.|..:|......:.:..|..|.::.:::..
  Rat   166 RTRTKVTIRLFQQQKHPQGSLDMGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRL 230

  Fly   210 LHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLE 274
            |.    |.::.|.:.|...|.....|.||                     ||.|.:|.....|.:
  Rat   231 LD----QGKSSLDVRIACEQCQESGASLV---------------------LLGKKKKKEVDGDGK 270

  Fly   275 KRRAGGG---SPPPPPPPPVDLYRPPQS--------------------CERLNFTVDFKELHMHN 316
            |:....|   ........|..:.:..||                    |.:..|.|.||::..::
  Rat   271 KKDGSDGGLEEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWND 335

  Fly   317 WVIAPKKFEAYFCGGGC-NFPLGTKMNATN-HAIVQTLMHLK-QPHLP----KPCCVPTVLGAIT 374
            |:|||..:.|.:|.|.| :...||..::.: |:.|  :.|.: :.|.|    |.|||||.|..::
  Rat   336 WIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTV--INHYRMRGHSPFANLKSCCVPTKLRPMS 398

  Fly   375 ILRYLNEDIIDLTKYQKAVAKECGC 399
            :|.|.:...|.....|..:.:||||
  Rat   399 MLYYDDGQNIIKKDIQNMIVEECGC 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 41/238 (17%)
TGFB 300..400 CDD:214556 35/107 (33%)
InhbaNP_058824.1 TGFb_propeptide 56..236 CDD:413528 31/191 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..306 6/41 (15%)
TGF_beta_INHBA 317..424 CDD:381674 35/109 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.