DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and MSTN

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_005250.1 Gene:MSTN / 2660 HGNCID:4223 Length:375 Species:Homo sapiens


Alignment Length:388 Identity:93/388 - (23%)
Similarity:143/388 - (36%) Gaps:76/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDD 95
            :::...|.::|.|.|..| .:.|.:..||:    ||   :|..::.....|...|..::....||
Human    44 WRQNTKSSRIEAIKIQIL-SKLRLETAPNI----SK---DVIRQLLPKAPPLRELIDQYDVQRDD 100

  Fly    96 DILISNEDRQEIASCNSILTFSSRL--------KPEQLDNELDMHITFNTNDVPVDLSLVQAMLR 152
            ....|.||....|:..:|:|..:..        ||:....:....|.:|        .:|:|.|.
Human   101 SSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYN--------KVVKAQLW 157

  Fly   153 IYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILG----SVNTTSSQRGWLEFNLTDTLRYWLHNK 213
            ||.:|  |:......|.:.|.:...:| ..|..|    .::.......|...::...|:.||.  
Human   158 IYLRP--VETPTTVFVQILRLIKPMKD-GTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLK-- 217

  Fly   214 GLQRRNELRISI------GDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRD 272
              |..:.|.|.|      |.....||      |......|.||:       |:.|.....|.:||
Human   218 --QPESNLGIEIKALDENGHDLAVTF------PGPGEDGLNPFL-------EVKVTDTPKRSRRD 267

  Fly   273 LEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPL 337
            ...              ..|.:.....|.|...|||| |....:|:||||:::|.:|.|.|.|..
Human   268 FGL--------------DCDEHSTESRCCRYPLTVDF-EAFGWDWIIAPKRYKANYCSGECEFVF 317

  Fly   338 GTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            ..|...|:      |:|...|. ...|||.||.:..|.:|.:..::.|...|....|...|||
Human   318 LQKYPHTH------LVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/232 (22%)
TGFB 300..400 CDD:214556 35/101 (35%)
MSTNNP_005250.1 TGFb_propeptide 39..249 CDD:279078 49/233 (21%)
TGFB 281..375 CDD:214556 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.