DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Tgfb3

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_037306.1 Gene:Tgfb3 / 25717 RGDID:3851 Length:412 Species:Rattus norvegicus


Alignment Length:447 Identity:103/447 - (23%)
Similarity:172/447 - (38%) Gaps:120/447 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SATTYVTTN-NHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPN-----------LHNSASKF 67
            |.:|..|.: .||:    :||..:.:.:::..|.|...|    ||:           |:||..:.
  Rat    23 SLSTCTTLDFGHIK----KKRVEAIRGQILSKLRLTSPP----EPSVMTHVPYQVLALYNSTREL 79

  Fly    68 LLEVYNE-----ISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDN 127
            |.|::.|     ..|..|.:....:.||    .|::....:..|:|.|           |:.:.:
  Rat    80 LEEMHGEREEGCTQETSESEYYAKEIHK----FDMIQGLAEHNELAVC-----------PKGITS 129

  Fly   128 ELDMHITFNTNDVPVD-LSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQD---FSYRILGSV 188
            ::   ..||.:.|..: .:|.:|..|:.:.|:...:|....:.:::.|  |.|   ...|.:|..
  Rat   130 KV---FRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQIL--RPDEHIAKQRYIGGK 189

  Fly   189 N-TTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIG-DSQLSTFAAGLVTPQASRTSLEPFI 251
            | .|.....||.|::|||:|.||    |:|.:.|.:.|. .....||              :|  
  Rat   190 NLPTRGTAEWLSFDVTDTVREWL----LRRESNLGLEISIHCPCHTF--------------QP-- 234

  Fly   252 VGYFNGP--ELLVKIQKLRFK----------RDLEKRRAGGGSPPPP------PPPPVDLYRPPQ 298
                ||.  |.:.::.:::||          .||.:.:.......|.      ||..:|  .|.|
  Rat   235 ----NGDILENVHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD--SPGQ 293

  Fly   299 SCER------LNFT--------------VDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNA 343
            ..:|      .|:.              :||::.....||..||.:.|.||.|.|.:   .:.:.
  Rat   294 GGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY---LRSSD 355

  Fly   344 TNHAIVQTLMHLKQPHL-PKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            |.|:.|..|.:...|.. ..|||||..|..:|||.|:.. ...:.:....|.|.|.|
  Rat   356 TTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGR-TPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/236 (22%)
TGFB 300..400 CDD:214556 32/121 (26%)
Tgfb3NP_037306.1 TGFb_propeptide 24..230 CDD:395559 54/237 (23%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.