DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Amh

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_037034.1 Gene:Amh / 25378 RGDID:2108 Length:553 Species:Rattus norvegicus


Alignment Length:323 Identity:76/323 - (23%)
Similarity:115/323 - (35%) Gaps:87/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LKPEQLDNELDMHITFNTNDVPVDLSLVQAM---------LRIYKQPSLVDRRANF--------- 166
            |:||.|.:..|..:...|.       ||:|:         .|:...|..:   |:|         
  Rat   274 LEPEDLPHSADPFLETLTR-------LVRALRGPLTRASNTRLALDPGAL---ASFPQGLVNLSD 328

  Fly   167 TVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHN-------KGLQRRNELRIS 224
            .|::.|.||..:.....:..:..|..           :.:|  ||:       .||.||..:.:.
  Rat   329 PVALGRLLDGEEPLLLLLSPAAATVG-----------EPMR--LHSPTSAPWAAGLARRVAVELQ 380

  Fly   225 IGDSQLSTFAAGL-------------VTPQASRTSLEPFIVGYFNGPELLVKIQKLRFK-RDLEK 275
            ...|:|... .||             :.|..||::.:|     .....||..:|.||.: |..|.
  Rat   381 AAASELRDL-PGLPPTAPPLLSRLLALCPNDSRSAGDP-----LRALLLLKALQGLRAEWRGREG 439

  Fly   276 RRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK 340
            |...|.|...         .....|.....:||   |.....|:.|:.::|..|.|.|.:|...:
  Rat   440 RGRAGRSKGT---------GTDGLCALRELSVD---LRAERSVLIPETYQANNCQGACAWPQSDR 492

  Fly   341 -MNATNHAIVQTLMHLKQPHLPK-PCCVPTVLGAIT--ILRYLNEDIIDLTKYQKAVAKECGC 399
             ....||.::...|..:...|.: ||||||   |.|  :|..|:|:.|........||.||||
  Rat   493 NPRYGNHVVLLLKMQARGAALGRLPCCVPT---AYTGKLLISLSEEHISAHHVPNMVATECGC 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 33/171 (19%)
TGFB 300..400 CDD:214556 33/104 (32%)
AmhNP_037034.1 AMH_N 74..417 CDD:282552 32/166 (19%)
TGFB 455..553 CDD:214556 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.