DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Gdf5

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_003749648.1 Gene:Gdf5 / 252835 RGDID:620102 Length:495 Species:Rattus norvegicus


Alignment Length:403 Identity:104/403 - (25%)
Similarity:166/403 - (41%) Gaps:52/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLH----QRHKRSLDD 95
            |.:.|.....:...|.....:|.....::.|.|||:...|....:||||...    ..|:..|..
  Rat   106 PQTRQAAARTVTPKGQLSGGKASAKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSL 170

  Fly    96 DILISNEDRQ--------EIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLR 152
            ...:|:.||:        |....|:|.:|..:.:.::..........|:.:.:..| .|:.|.||
  Rat   171 YRTLSDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKD-GLLGAELR 234

  Fly   153 IY-KQPSLVDRRANFTVSVYRKL------DNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL 210
            |. |:|..|.:.|..:.....:|      ..||..:...:.||...... ||..|::....|.:.
  Rat   235 ILRKKPLDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGS-GWEVFDIWKLFRNFK 298

  Fly   211 HNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEP--FIV-GYFNGPELLVKIQKLRFKRD 272
            ::..|.    |.:...:...:....||...:|:|...|.  |:| |.....:|.....|.|..:|
  Rat   299 NSAQLC----LELEAWERGRAVDLRGLGFERAARQVHEKALFLVFGRTKKRDLFFNEIKARSGQD 359

  Fly   273 -----------LEKRRAGGGSPPPPPPPPVDLYRPPQS----CERLNFTVDFKELHMHNWVIAPK 322
                       ..||||        |.......||.::    |.|....|:||::...:|:|||.
  Rat   360 DKTVYEYLFSQRRKRRA--------PLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPL 416

  Fly   323 KFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDL 386
            ::||:.|.|.|.|||.:.:..||||::||||:...|. .|..|||||.|..|:||...:.:.:..
  Rat   417 EYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVY 481

  Fly   387 TKYQKAVAKECGC 399
            .:|:..|.:.|||
  Rat   482 KQYEDMVVESCGC 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 50/236 (21%)
TGFB 300..400 CDD:214556 41/101 (41%)
Gdf5XP_003749648.1 TGFb_propeptide 147..338 CDD:413528 41/196 (21%)
TGF_beta_GDF5 393..495 CDD:381669 41/102 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.