DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Nodal

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_038639.2 Gene:Nodal / 18119 MGIID:97359 Length:354 Species:Mus musculus


Alignment Length:302 Identity:73/302 - (24%)
Similarity:128/302 - (42%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TFNTNDVPVDLSLVQAMLRI-YKQPSLVDRRANFTVSVYR--KLDNRQD----------FSYRIL 185
            ||:.:.:..:..||.|.||: ...|..:......|:.::.  |.|..:|          .::.::
Mouse    77 TFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVI 141

  Fly   186 GSVNTTSSQRGWLEFNLTDTLRYWLHN-KGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEP 249
            .|..|.:|....||  :|..|..||.: :.|:::                   |:.:|.:...:|
Mouse   142 PSQVTFASGSTVLE--VTKPLSKWLKDPRALEKQ-------------------VSSRAEKCWHQP 185

  Fly   250 FIVGYFNGPELLVKIQKLRFKRDLEKRRAGGG-------SPPPPPPPPVDLYR------------ 295
            :....   |.....:..|...|..|:|:.||.       |........:.:.|            
Mouse   186 YTPPV---PVASTNVLMLYSNRPQEQRQLGGATLLWEAESSWRAQEGQLSVERGGWGRRQRRHHL 247

  Fly   296 PPQS--CERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP 358
            |.:|  |.|:.|.|||..:...:|:|.||::.||.|.|.|..|:|.:.:.||||.:|:|:...||
Mouse   248 PDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQP 312

  Fly   359 H-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            | :|..||.|.....:::| |::...:.|..::..:.:||||
Mouse   313 HRVPSTCCAPVKTKPLSML-YVDNGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 25/133 (19%)
TGFB 300..400 CDD:214556 37/101 (37%)
NodalNP_038639.2 TGFb_propeptide 33..169 CDD:279078 21/93 (23%)
TGFB 254..353 CDD:214556 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.