DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and tig-2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_504271.1 Gene:tig-2 / 178864 WormBaseID:WBGene00006570 Length:366 Species:Caenorhabditis elegans


Alignment Length:395 Identity:97/395 - (24%)
Similarity:156/395 - (39%) Gaps:102/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LSEQMEMIDILDLGDRPRRQAEPN-----LHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDD 95
            :.||:..:..:|:        .||     .:|..|.::..:|.:: |:.|..|            
 Worm    44 IGEQIRELFNIDI--------NPNGPAVKANNYVSTYMKRLYKQL-ENYEHGE------------ 87

  Fly    96 DILISNEDRQEI---ASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPV--DLSLVQAMLRIYK 155
                 |.:.:|:   .|.:.|::..::....:||:. ...|.|....||.  ..|:|:|.|||:.
 Worm    88 -----NHNEEEVNAWLSADRIVSHMAQEVSHRLDDG-SYSIRFAKEHVPAKEGQSIVRAQLRIHI 146

  Fly   156 QPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNE 220
            |        .....|:..:::.     .:.|.....||....:..::|..:..|.|         
 Worm   147 Q--------GIVSPVFFYIEDT-----NLPGDTVLVSSDDPTVVTDVTTMVDRWSH--------- 189

  Fly   221 LRISIGDSQLSTFAAGLVTPQAS---RTSLEPFIVGYFN----GPELLVKIQKLRFKRDLEKRRA 278
                   .||||..  :||.:||   ...:|.|:|....    ||.              :||..
 Worm   190 -------LQLSTLP--IVTARASTNDELKIEAFLVIALKDEDAGPP--------------KKRSR 231

  Fly   279 GGGSPPPPPPPPV---------DLYRPP---QSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGG 331
            ...|..|...||:         ..:..|   :.|:|....|||..|....|||||:.|.|::|.|
 Worm   232 RSASTTPISAPPMRQKVKRSESAYFEKPNENERCQRKGLYVDFDILGWKQWVIAPEGFSAFYCSG 296

  Fly   332 GCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPC-CVPTVLGAITILRYLNEDIIDLTKYQKAVAK 395
            .|:.|...:||||:|||||:.:|..:|:...|. |.|:.||:..||.......:.:.:|:..|..
 Worm   297 DCSAPFSKEMNATSHAIVQSTLHRVRPNSTTPAKCAPSSLGSYKILFVDQNKQVQIKRYRDMVVD 361

  Fly   396 ECGCH 400
            |||||
 Worm   362 ECGCH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 45/227 (20%)
TGFB 300..400 CDD:214556 40/100 (40%)
tig-2NP_504271.1 TGF_beta_BMP5_like 264..366 CDD:381639 40/101 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 1 1.000 - - otm14565
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.