DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and unc-129

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_501566.1 Gene:unc-129 / 177719 WormBaseID:WBGene00006852 Length:407 Species:Caenorhabditis elegans


Alignment Length:396 Identity:72/396 - (18%)
Similarity:114/396 - (28%) Gaps:175/396 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISED 78
            |....:..|..|.:|     ||.:|.:             |::.|         .|.:|::::..
 Worm   176 AKQAVFRITREHSKM-----RPYAEMI-------------RKSTP---------FLVIYSKVNHT 213

  Fly    79 QEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVD 143
            .:...|:.|                           |..::.|...|.|| ::...:|.|.:|:|
 Worm   214 LDTVSVMKQ---------------------------TEQTKRKRRDLGNE-ELREYYNYNSIPLD 250

  Fly   144 LSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRY 208
            ..               ||.     .:.||...:...|..|       ||:..|..|        
 Worm   251 ND---------------DRE-----PIKRKNGKKNSLSEEI-------SSEDVWQGF-------- 280

  Fly   209 WLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDL 273
                 |.:...|.|..|.:.:|:                                       .|:
 Worm   281 -----GEETSREERERIANEELA---------------------------------------NDV 301

  Fly   274 EKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLG 338
            .                |.|.:....|.:....|..|......:||.||..|..||.|.|..|:.
 Worm   302 R----------------VVLLQNKNRCHKEGVLVSLKHFGWDRYVIEPKTIETSFCKGKCAKPML 350

  Fly   339 TKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAI----------TILRYLNEDIIDLTKYQKAV 393
            |...|:|||::|:|. ..:|    .||.||.|.::          |::|          .|.|.:
 Worm   351 TSGKASNHAMLQSLF-AAEP----VCCAPTNLKSLNFWYRDEKGRTVIR----------NYSKML 400

  Fly   394 AKECGC 399
            ...|.|
 Worm   401 IGSCSC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 30/214 (14%)
TGFB 300..400 CDD:214556 32/110 (29%)
unc-129NP_501566.1 TGFB 312..406 CDD:214556 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.