DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and GDF7

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_878248.2 Gene:GDF7 / 151449 HGNCID:4222 Length:450 Species:Homo sapiens


Alignment Length:253 Identity:69/253 - (27%)
Similarity:96/253 - (37%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNG---- 257
            |..|::.|.:|        :.|.|.|.......|....||   |..|..:|.....|:..|    
Human   208 WEAFDVADAMR--------RHRREPRPPRAFCLLLRAVAG---PVPSPLALRRLGFGWPGGGGSA 261

  Fly   258 ---PELLVKIQKLRFKRDL------EKRRAGGGSPPPPPPPPVDLYRPPQS-------------- 299
               ..:||...:.:.|..|      :.|..|......|.|.|......|::              
Human   262 AEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAG 326

  Fly   300 ----------------------CERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMN 342
                                  |.|....||||||...:|:|||..:|||.|.|.|:|||.:.:.
Human   327 TRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLE 391

  Fly   343 ATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            .|||||:|||::...|. .|..||||..|..|:||.....:.:...:|:..|.:.|||
Human   392 PTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGC 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 13/56 (23%)
TGFB 300..400 CDD:214556 44/101 (44%)
GDF7NP_878248.2 TGFb_propeptide <91..>217 CDD:279078 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..349 4/52 (8%)
TGFB 352..450 CDD:214556 42/98 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.