DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Gdf2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_062379.3 Gene:Gdf2 / 12165 MGIID:1321394 Length:428 Species:Mus musculus


Alignment Length:427 Identity:101/427 - (23%)
Similarity:182/427 - (42%) Gaps:101/427 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EMPIYQKRPLSEQMEM-----IDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLH 86
            |..::..:...|.|::     :::..:..:.:.:|||      .::::::||..:.|:......:
Mouse    48 EEGVFDLQMFLENMKVDFLRSLNLSGIPSQDKTRAEP------PQYMIDLYNRYTTDKSSTPASN 106

  Fly    87 QRHKRSLDDDILISNEDRQEIASCNSILTFSSRL-KPEQLDN-ELDMHITFNTNDVPVDLSLVQA 149
            .....|::|  .||....::......||.|:..: :.||:.. ||.::::.. |||.....|..:
Mouse   107 IVRSFSVED--AISTAATEDFPFQKHILIFNISIPRHEQITRAELRLYVSCQ-NDVDSTHGLEGS 168

  Fly   150 MLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQ----RGWLEFNLTDTLRYWL 210
            |:                  ||..|::.:.:. :..|:.....||    .||....::..::.|:
Mouse   169 MV------------------VYDVLEDSETWD-QATGTKTFLVSQDIRDEGWETLEVSSAVKRWV 214

  Fly   211 HNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFN-----------------GP 258
            .......:|:|.:::...:.|.....:..|..|:..  ||.|.:.|                 |.
Mouse   215 RADSTTNKNKLEVTVQSHRESCDTLDISVPPGSKNL--PFFVVFSNDRSNGTKETRLELKEMIGH 277

  Fly   259 E---LLVKIQKLRFKRDLE-------------------KRRAGGGSPPPPPPPPVDLYRPPQSCE 301
            |   :|||..|..::...|                   ::|:.|.|               ..|:
Mouse   278 EQETMLVKTAKNAYQVAGESQEEEGLDGYTAVGPLLARRKRSTGAS---------------SHCQ 327

  Fly   302 RLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP-HLPKPCC 365
            :.:..|:|:::...:|:||||:::||.|.|||.|||...:..|.|||||||:|||.| .:.|.||
Mouse   328 KTSLRVNFEDIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACC 392

  Fly   366 VPTVLGAITILRYLNEDIIDLTKYQ---KAVAKECGC 399
            |||.|..|:|| |.::..:...||.   .:|| ||||
Mouse   393 VPTKLSPISIL-YKDDMGVPTLKYHYEGMSVA-ECGC 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 40/225 (18%)
TGFB 300..400 CDD:214556 48/104 (46%)
Gdf2NP_062379.3 TGFb_propeptide 75..256 CDD:279078 39/210 (19%)
TGF_beta 325..427 CDD:278448 46/103 (45%)
Interaction with ENG. /evidence=ECO:0000250|UniProtKB:Q9UK05 401..415 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.