DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp4

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001303289.1 Gene:Bmp4 / 12159 MGIID:88180 Length:408 Species:Mus musculus


Alignment Length:398 Identity:99/398 - (24%)
Similarity:163/398 - (40%) Gaps:109/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFS 117
            ||:.:|:.......::.::|...|.::|.:|   |.....|:       ...:..:..|::.:|.
Mouse    68 RRRPQPSKSAVIPDYMRDLYRLQSGEEEEEE---QSQGTGLE-------YPERPASRANTVRSFH 122

  Fly   118 SRLKPEQLDN------ELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANF-----TVSVY 171
            ..   |.|:|      .......||.:.:|.:..:..|.||::::.  ||:..::     .:::|
Mouse   123 HE---EHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQ--VDQGPDWEQGFHRINIY 182

  Fly   172 ----------------RKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYW----------- 209
                            |.||.|       |...|.|.    |..|:::..:..|           
Mouse   183 EVMKPPAEMVPGHLITRLLDTR-------LVHHNVTR----WETFDVSPAVLRWTREKQPNYGLA 236

  Fly   210 -----LHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASR--TSLEPFIVGYFNGPELLVKIQKL 267
                 ||.....:...:|||..            .||.|.  ..|.|.:|               
Mouse   237 IEVTHLHQTRTHQGQHVRISRS------------LPQGSGDWAQLRPLLV--------------- 274

  Fly   268 RFKRD-----LEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAY 327
            .|..|     |.:|||    ...|...|....:..::|.|.:..|||.::..::|::||..::|:
Mouse   275 TFGHDGRGHTLTRRRA----KRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAF 335

  Fly   328 FCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAITILRYLNE-DIIDLTKYQK 391
            :|.|.|.|||...:|:|||||||||::.....:||.|||||.|.||::| ||:| |.:.|..||:
Mouse   336 YCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISML-YLDEYDKVVLKNYQE 399

  Fly   392 AVAKECGC 399
            .|.:.|||
Mouse   400 MVVEGCGC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/245 (18%)
TGFB 300..400 CDD:214556 47/101 (47%)
Bmp4NP_001303289.1 TGFb_propeptide 41..276 CDD:279078 44/260 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..111 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..307 6/29 (21%)
TGFB 308..408 CDD:214556 47/101 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.