DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp15

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_033887.1 Gene:Bmp15 / 12155 MGIID:1316745 Length:392 Species:Mus musculus


Alignment Length:408 Identity:87/408 - (21%)
Similarity:162/408 - (39%) Gaps:68/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IEMPIYQKRP-------LSEQMEMIDILDLG-DRPRRQAEPNLHNSASKFLLEVYNEISEDQEPK 82
            :|..:...:|       |::...:..||||. :.|.::.:........:::|::|:..::...  
Mouse    18 MEQRVQMAKPGWPSTALLADDPTLPSILDLAKEAPGKEMKQWPQGYPLRYMLKLYHRSADPHG-- 80

  Fly    83 EVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVP-----V 142
               |.|..|::...::     |....|.|::       :|.:    ...|:  .|.|.|     |
Mouse    81 ---HPRENRTIGAKMV-----RLVKPSANTV-------RPPR----GSWHV--QTLDFPLASNQV 124

  Fly   143 DLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLR 207
            ...|::|.:....|..||:...:..|..:......:.......||...:...:.|.|.::|..::
Mouse   125 AYELIRATVVYRHQLHLVNYHLSCHVETWVPKCRTKHLPSSKSGSSKPSPMSKAWTEIDITHCIQ 189

  Fly   208 YWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQ---ASRTSLE-PFIVGYFNGPE------LLV 262
            ..|.|:  :.|:.||:.....|    ..|..|.:   ...|||: .|::.|||..:      ||.
Mouse   190 QKLWNR--KGRSVLRLRFMCQQ----QKGNETREFRWHGMTSLDVAFLLLYFNDTDDRVQGKLLA 248

  Fly   263 KIQK----------LRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNW 317
            :.|:          :|..|......:....|.......|:     ..|....:.|.|.:|...:|
Mouse   249 RGQEELTDRESSFLMRSVRQACSIESDASCPSQEHDGSVN-----NQCSLHPYKVSFHQLGWDHW 308

  Fly   318 VIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMH-LKQPHLPKPCCVPTVLGAITILRYLNE 381
            :|||:.:...:|.|.|...|...:|:.||||:|:|:: |....:|:|.|||.....::||.....
Mouse   309 IIAPRLYTPNYCKGICTRVLPYGLNSPNHAIIQSLVNELVNHSVPQPSCVPYNFLPMSILLIETN 373

  Fly   382 DIIDLTKYQKAVAKECGC 399
            ..|...:|:..:|:.|.|
Mouse   374 GSILYKEYEGMIAQSCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 42/224 (19%)
TGFB 300..400 CDD:214556 32/101 (32%)
Bmp15NP_033887.1 TGF_beta 289..391 CDD:278448 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.