DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Amh

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_031471.2 Gene:Amh / 11705 MGIID:88006 Length:554 Species:Mus musculus


Alignment Length:207 Identity:57/207 - (27%)
Similarity:80/207 - (38%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GLQRRNELRISIGDSQLSTFAAGL-------------VTPQASRTSLEPFIVGYFNGPELLVKIQ 265
            |||||..:.:....|:|... .||             :.|..||:|.:|     .....||..:|
Mouse   371 GLQRRVAVELQAAASELRDL-PGLPPTAPPLLARLLALCPNDSRSSGDP-----LRALLLLKALQ 429

  Fly   266 KLRFK------RDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKF 324
            .||.:      |....|.||.|:..|              |.....:||   |.....|:.|:.:
Mouse   430 GLRAEWHGREGRGRTGRSAGTGTDGP--------------CALRELSVD---LRAERSVLIPETY 477

  Fly   325 EAYFCGGGCNFPLGTK-MNATNHAIVQTLMHLKQPHLPK-PCCVPTVLGAITILRYLNEDIIDLT 387
            :|..|.|.|.:|...: ....||.::...|..:...|.: ||||||.. |..:|..|:|:.|...
Mouse   478 QANNCQGACAWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAY-AGKLLISLSEERISAH 541

  Fly   388 KYQKAVAKECGC 399
            .....||.||||
Mouse   542 HVPNMVATECGC 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 14/52 (27%)
TGFB 300..400 CDD:214556 32/102 (31%)
AmhNP_031471.2 AMH_N 76..396 CDD:282552 9/25 (36%)
TGFB 456..554 CDD:214556 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.