Sequence 1: | NP_001286088.1 | Gene: | scw / 46000 | FlyBaseID: | FBgn0005590 | Length: | 400 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031471.2 | Gene: | Amh / 11705 | MGIID: | 88006 | Length: | 554 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 57/207 - (27%) |
---|---|---|---|
Similarity: | 80/207 - (38%) | Gaps: | 45/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 GLQRRNELRISIGDSQLSTFAAGL-------------VTPQASRTSLEPFIVGYFNGPELLVKIQ 265
Fly 266 KLRFK------RDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKF 324
Fly 325 EAYFCGGGCNFPLGTK-MNATNHAIVQTLMHLKQPHLPK-PCCVPTVLGAITILRYLNEDIIDLT 387
Fly 388 KYQKAVAKECGC 399 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scw | NP_001286088.1 | TGFb_propeptide | 39..254 | CDD:279078 | 14/52 (27%) |
TGFB | 300..400 | CDD:214556 | 32/102 (31%) | ||
Amh | NP_031471.2 | AMH_N | 76..396 | CDD:282552 | 9/25 (36%) |
TGFB | 456..554 | CDD:214556 | 32/102 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3900 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |