DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp3

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001297606.1 Gene:Bmp3 / 110075 MGIID:88179 Length:470 Species:Mus musculus


Alignment Length:418 Identity:83/418 - (19%)
Similarity:146/418 - (34%) Gaps:144/418 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNVFFLTSLFYA---ASATTYV---------------------TTNNHIEMPIYQKRPLSEQMEM 42
            |:.|.||||..:   .|||.|.                     |...||::.:......|.|.::
Mouse   111 LHTFNLTSLTKSENILSATLYFYVGELVNISLSCPEPQGCSHHTQRQHIQIDLSAWILKSNQSQL 175

  Fly    43 -----IDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQE------PKEVLHQRHKRSL--- 93
                 :|::    ||.|.:...|    ||.:.::..:..:::|      .....|:..||.|   
Mouse   176 LGHLSVDVV----RPYRDSVSWL----SKDITQLLRKAKQNEEFLIGFNITSRAHELPKRMLFFP 232

  Fly    94 DDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVP-VDLSLVQAMLRIYKQP 157
            :..||:...|             ::..:||.:.:.|..|..|.....| :|..:.:|:       
Mouse   233 EPYILVYAND-------------AAISEPESVVSSLQRHRDFTAGTGPRLDSHVREAL------- 277

  Fly   158 SLVDRRANFTVSVYRKLDNRQ----DFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRR 218
             .|:||...:..:...|.|.:    ::.|:..|:         |.|.....:|:.....|.   |
Mouse   278 -SVERRKKRSTGILLPLQNNELPGAEYQYKEEGA---------WEERKPYKSLQTQPPEKS---R 329

  Fly   219 NELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRF-KRDLEKRRAGGGS 282
            |:.:...|..|                                 |.|.|:| ::.|:|.|.    
Mouse   330 NKKKQRKGSHQ---------------------------------KGQTLQFDEQTLKKARR---- 357

  Fly   283 PPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLG--TKMNATN 345
                     ..:..|::|.|....|||.::....|:|:||.|:|::|.|.|.||:.  ....|..
Mouse   358 ---------KQWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKVAAAAAAL 413

  Fly   346 HAIVQTLMH-----------LKQPHLPK 362
            |.::.:.:|           :|..|.|:
Mouse   414 HLVLISFLHGVEEYAKFFETIKSRHHPE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 39/233 (17%)
TGFB 300..400 CDD:214556 22/76 (29%)
Bmp3NP_001297606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..349 10/70 (14%)
TGF_beta 364..>424 CDD:278448 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.