DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and gdf5

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_002662587.1 Gene:gdf5 / 100334210 ZFINID:ZDB-GENE-990415-39 Length:474 Species:Danio rerio


Alignment Length:430 Identity:105/430 - (24%)
Similarity:173/430 - (40%) Gaps:83/430 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AASATTYVTTNNHIEMPIYQK--RPLSEQMEMIDILDLGDRP---RRQAEPNLHNSAS------- 65
            ||:..:..:..:|.:....||  .|.:.:.....|..:...|   |.::...|.||..       
Zfish    84 AANLASPSSIQHHSKAASTQKSSAPAAVRAAPAGIKSIAPAPSHLRMKSAVKLENSEEPKHPLVI 148

  Fly    66 --KFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNE 128
              .::|.:|..::.......|||                   |....|:|.:|..|.:.|:....
Zfish   149 PHDYMLSLYWSLTSGDVNTSVLH-------------------EAGMANTITSFVDRGQDERAPLL 194

  Fly   129 LDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFT--VSVYRKLDNRQDFSYRILGSVNTT 191
            ......||.:.:..: .|:.|.|||.::..:..|:|.|:  ::|.|........:..:|......
Zfish   195 RRQRYVFNISSMEKE-GLLGAELRILRKKHMDSRKATFSEGMAVLRLFTCASGKNAAVLLQARPF 258

  Fly   192 SSQRG--WLEFNLTDTLRYWLHNKGLQRRNELRISIG--------DSQLSTFAAGLVTPQASRTS 246
            .|...  |..|::      |...|..:...:|.:.:.        |.:|      |...:|.|.:
Zfish   259 DSHSASYWEVFDI------WKVFKNFRNTPQLCLELDAVDHGRPLDLRL------LGLSRAGRQT 311

  Fly   247 LEP--FIV-------GYF-------NGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYR 295
            .|.  |:|       |.|       :|.:.....:.|..:|.:  |||    |.|....|:.  .
Zfish   312 KEKAFFVVFGRTKKRGLFYNEIKARSGHDNKTVYEYLFTQRRM--RRA----PLPRGKKPIK--N 368

  Fly   296 PPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH- 359
            |.|.|.|....|:|||:...:|:|||.::||:.|.|.|:||:.:.:..|||||:||||:...|. 
Zfish   369 PKQRCNRKQLHVNFKEMGWDDWIIAPLEYEAFHCDGVCDFPIRSHLEPTNHAIIQTLMNSMDPRS 433

  Fly   360 LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            .|..|||||.|..|:||...:.:.:...:|:..|.:.|||
Zfish   434 TPPTCCVPTRLSPISILYIDSANNVVYKQYEDMVVESCGC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/247 (18%)
TGFB 300..400 CDD:214556 42/101 (42%)
gdf5XP_002662587.1 TGFb_propeptide 138..320 CDD:279078 39/213 (18%)
TGF_beta 371..473 CDD:278448 41/101 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.