DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and LOC100329520

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_002662616.2 Gene:LOC100329520 / 100329520 -ID:- Length:368 Species:Danio rerio


Alignment Length:436 Identity:91/436 - (20%)
Similarity:155/436 - (35%) Gaps:140/436 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AASATTYVTTNNHIEMPIYQKRPLSEQMEMIDI--------LDLGDRPR-RQAEP---------N 59
            |.:|||...|   ..:|..:|.  |||..:::|        |.|.:||. .|..|         .
Zfish    23 ARAATTGCPT---CGLPAMEKG--SEQQYLVEIAKQQILSKLHLRERPNITQTVPRAALMTALRK 82

  Fly    60 LHNSASKF----LLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRL 120
            ||  |.:.    .||:.|.:...:                    |:....||.|...|       
Zfish    83 LH--AGRIRQDGTLELENNLPNSR--------------------SSNQAYEIVSFADI------- 118

  Fly   121 KPEQLDNELDMHITFN-TNDVPVDLSLVQAMLRIYKQPSLVDR---------RANFTVSVYRKLD 175
             ...|.|.:|..::|. ..:....:.::|:.|.:|.:||...|         ..|.|:.:.|.:|
Zfish   119 -DGDLPNSIDTSLSFQFLQEKGHSVQVLQSSLWLYLRPSESSRISAEIYLSDSTNRTLVLQRSVD 182

  Fly   176 NRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTP 240
                            :::.||..|.:|.||:.:|  .|.|||..|.:...|:     ...|...
Zfish   183 ----------------AARGGWHTFPVTSTLQAFL--DGGQRRLRLEVQCQDA-----GRNLCKK 224

  Fly   241 QASR-TSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLN 304
            :.:. :|.:||:|..       |::::...|..|.||....|.         |:    ..|.:.:
Zfish   225 EPTEDSSHQPFLVAQ-------VRLREDPSKHALSKRSLRCGD---------DV----TVCCKKD 269

  Fly   305 FTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLG----------------TKMNATNHAIVQTLM 353
            |.:.|:::...:|:|||:.:...:|.|.|...|.                .|.|..|.|:     
Zfish   270 FYIKFRDIQWQDWIIAPEGYHMNYCMGQCPQHLSGSPGIASSFHASVFSQLKANGINTAV----- 329

  Fly   354 HLKQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
                    ..||||.....::::.:.::..|..|.....:.:.|||
Zfish   330 --------SSCCVPIQRRPLSMVYFNSQHTIVKTDVPDMIVESCGC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/247 (21%)
TGFB 300..400 CDD:214556 24/116 (21%)
LOC100329520XP_002662616.2 TGFb_propeptide 54..238 CDD:279078 48/236 (20%)
TGF_beta 265..367 CDD:278448 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.