DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)M3 and ELSPBP1

DIOPT Version :9

Sequence 1:NP_572284.4 Gene:fs(1)M3 / 45994 FlyBaseID:FBgn0005390 Length:1836 Species:Drosophila melanogaster
Sequence 2:XP_016882619.1 Gene:ELSPBP1 / 64100 HGNCID:14417 Length:268 Species:Homo sapiens


Alignment Length:47 Identity:15/47 - (31%)
Similarity:22/47 - (46%) Gaps:9/47 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1743 QQLSFQERIQQLTPFKVGNEQYLLVVTQPEEEHFYLFSYNEVGGWQQ 1789
            |..||::|..::|.:    ..|||..|.     |.|:||...||..:
Human    35 QLWSFEKRAAKMTRW----SSYLLGWTT-----FLLYSYESSGGMHE 72



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22918
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.