powered by:
Protein Alignment fs(1)M3 and ELSPBP1
DIOPT Version :9
Sequence 1: | NP_572284.4 |
Gene: | fs(1)M3 / 45994 |
FlyBaseID: | FBgn0005390 |
Length: | 1836 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016882619.1 |
Gene: | ELSPBP1 / 64100 |
HGNCID: | 14417 |
Length: | 268 |
Species: | Homo sapiens |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 22/47 - (46%) |
Gaps: | 9/47 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1743 QQLSFQERIQQLTPFKVGNEQYLLVVTQPEEEHFYLFSYNEVGGWQQ 1789
|..||::|..::|.: ..|||..|. |.|:||...||..:
Human 35 QLWSFEKRAAKMTRW----SSYLLGWTT-----FLLYSYESSGGMHE 72
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22918 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.