DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and ECM5

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_013901.1 Gene:ECM5 / 855214 SGDID:S000004788 Length:1411 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:41/127 - (32%)
Similarity:64/127 - (50%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 FKQVRQLYEINDDPKRK--EFLDDLFSFMQK-RGTPINRLPIMAKSVLDLYELYNLVIARGGLVD 342
            ||..:|.:..|:..:.|  :|...|::|..| :.:.:.|:|.:.|..||||.|.:.|..|||...
Yeast   171 FKARKQFFNSNEFQRTKIVDFYAKLYNFHNKIKKSTLTRIPSIDKRTLDLYRLRSCVKLRGGFNA 235

  Fly   343 VINKKLWQEIIKGLHLPSSITSAAFT-LRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRRE 403
            |..||||.:|.:.|.....|.|:..| ||:.|.|.|..::..::      |.|||.:..:.|
Yeast   236 VCEKKLWAQIGRELGYSGRIMSSLSTSLRSAYAKILLDFDIYEE------EEQAARNNEKNE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777 32/95 (34%)
ECM5NP_013901.1 BRIGHT 187..280 CDD:128777 32/98 (33%)
cupin_RmlC-like 512..662 CDD:424065
PHD_Ecm5p_Lid2p_like 1240..1287 CDD:276993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I2799
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4750
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.