powered by:
Protein Alignment retn and RSC9
DIOPT Version :9
Sequence 1: | NP_788434.1 |
Gene: | retn / 45976 |
FlyBaseID: | FBgn0004795 |
Length: | 911 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013579.1 |
Gene: | RSC9 / 854912 |
SGDID: | S000004596 |
Length: | 581 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 77 |
Identity: | 18/77 - (23%) |
Similarity: | 29/77 - (37%) |
Gaps: | 6/77 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 557 EALSAQVALWHMYHNNNSPPGSAHTSPQQREALNLSDSPPNLTNIKREREREPTPEPVDQDDKFV 621
||...|::||..|.:....| .....|:.|...:...|::|...........:||....:||
Yeast 408 EAEFTQISLWRSYESKFGQP----VRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFV 468
Fly 622 DQ--PPPAKRVG 631
.: .|..|.:|
Yeast 469 IKGIQPRFKALG 480
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
retn | NP_788434.1 |
BRIGHT |
294..386 |
CDD:128777 |
|
RSC9 | NP_013579.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1374 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.