DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and RSC9

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_013579.1 Gene:RSC9 / 854912 SGDID:S000004596 Length:581 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:18/77 - (23%)
Similarity:29/77 - (37%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 EALSAQVALWHMYHNNNSPPGSAHTSPQQREALNLSDSPPNLTNIKREREREPTPEPVDQDDKFV 621
            ||...|::||..|.:....|    .....|:.|...:...|::|...........:||....:||
Yeast   408 EAEFTQISLWRSYESKFGQP----VRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFV 468

  Fly   622 DQ--PPPAKRVG 631
            .:  .|..|.:|
Yeast   469 IKGIQPRFKALG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777
RSC9NP_013579.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.