DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and AT1G76110

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_177738.1 Gene:AT1G76110 / 843943 AraportID:AT1G76110 Length:338 Species:Arabidopsis thaliana


Alignment Length:129 Identity:39/129 - (30%)
Similarity:61/129 - (47%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SASNSSTSSEASNSSQQNNGWSFEEQFKQVRQLYE--INDDPKRKEFLDDLFSFMQKRGTPINRL 317
            |:.|.||.|:|:......:....:| :.:...|:|  :.|.   ..|.|.|..|.....|.. .:
plant     2 SSDNESTPSQATVEMMATSPAKIKE-YPEPLALHEVVVKDS---SVFWDTLRRFHSIMSTKF-MI 61

  Fly   318 PIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYE 381
            |::....|||:.||..|..|||...|:.:|.|:|:.......::.|||:|.||..|:..|:.||
plant    62 PVIGGKELDLHVLYVEVTRRGGYEKVVVEKKWREVGGVFRFSATTTSASFVLRKHYLNLLFHYE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777 29/88 (33%)
AT1G76110NP_177738.1 BRIGHT 39..128 CDD:128777 30/91 (33%)
HMGB-UBF_HMG-box 255..318 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.