DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and AT1G55650

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_175961.1 Gene:AT1G55650 / 842014 AraportID:AT1G55650 Length:337 Species:Arabidopsis thaliana


Alignment Length:205 Identity:52/205 - (25%)
Similarity:90/205 - (43%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SASNSSTSSEASNSSQQ--NNGWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRL 317
            ||.::..||..|...|.  .|...|   ::.:|..:|.:|    |:|                ::
plant    16 SALDNDVSSHMSMLYQDIVRNPELF---WEMLRDFHESSD----KKF----------------KI 57

  Fly   318 PIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYEC 382
            ||:....|||:.|:|.|.:||||..||..:..:|:|...:..::||::||.||..|:|.|:.:|.
plant    58 PIVGGKSLDLHRLFNEVTSRGGLEKVIKDRRCKEVIDAFNFKTTITNSAFVLRKSYLKMLFEFEH 122

  Fly   383 -------------EKKNLSTPAELQAAIDGNRREGRRSSY------GQYEAMHNQMPMTPISRPS 428
                         ::|.|....|..|..|.:.:|.:..:.      |::|:  ..:..|.:....
plant   123 LYYFQAPLSTFWEKEKALKLLIEKSANRDKDSQELKPGTVITGIIDGKFES--GYLISTKVGSEK 185

  Fly   429 LPGGMQQMSP 438
            |.|.:..:||
plant   186 LKGMLYHISP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777 28/104 (27%)
AT1G55650NP_175961.1 BRIGHT 35..126 CDD:128777 33/113 (29%)
HMGB-UBF_HMG-box 215..278 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001099
OrthoInspector 1 1.000 - - otm2864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.