DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and AT1G20910

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_173515.2 Gene:AT1G20910 / 838684 AraportID:AT1G20910 Length:398 Species:Arabidopsis thaliana


Alignment Length:327 Identity:69/327 - (21%)
Similarity:119/327 - (36%) Gaps:91/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GSGGGGGGGGGGGGGVG--------GHQFSFASP-TAAPSGKEARHFAANSASNSSTSSEASNSS 269
            |.|....|.|..||.||        ..:....|| |...:.|:.:.:..:|.:..  :.||....
plant    45 GDGQANNGHGMNGGAVGVVDHSERKTRRVQMLSPKTEGENAKKRKTWLLDSEAQG--TDEAGTPV 107

  Fly   270 QQNNGWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLV 334
            :|   .:|   .::|...|       ::.||:  |...:..|.|:|           :.:|:..|
plant   108 EQ---VAF---LREVEAFY-------KESFLE--FKPPKFYGQPLN-----------ILKLWRAV 146

  Fly   335 IARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYE-CEKKN--LSTPAE---L 393
            :..||...|...|||:::.:..:.|.:.|:.::|.|..|.|.|..|| |.:.|  |:.|..   |
plant   147 VNLGGYEVVTTNKLWRQVGESFNPPKTCTTVSYTFRNFYEKALLEYEKCLRNNGELNLPGSTLIL 211

  Fly   394 QAAID---------GNRREGRRSSYGQYEAMHNQ-----------------MPMTPISRPSLPGG 432
            .::::         |:.|..|.|:....:..|.|                 :..||..:.....|
plant   212 SSSVEKEPSSHQGSGSGRARRDSAARAMQGWHAQRLVGSGEVTAPAVKDKGLISTPKHKKLKSIG 276

  Fly   433 MQQMSPLALVTHAAVANNQQAQAAAAAAAAHHRLMGAPA----------------FGQMPNLVKQ 481
            :|:......:.| .|.|....|.||....     :|..|                |..:|.|:::
plant   277 LQKHKQQTSMDH-VVTNEADKQLAAEVVD-----VGPVADWVKINVKESKDSFEIFALVPGLLRK 335

  Fly   482 EI 483
            |:
plant   336 EV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777 24/92 (26%)
AT1G20910NP_173515.2 BRIGHT 108..198 CDD:128777 28/115 (24%)
alpha-crystallin-Hsps_p23-like 316..395 CDD:412199 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.