Sequence 1: | NP_788434.1 | Gene: | retn / 45976 | FlyBaseID: | FBgn0004795 | Length: | 911 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_566454.1 | Gene: | AT3G13350 / 820535 | AraportID: | AT3G13350 | Length: | 319 | Species: | Arabidopsis thaliana |
Alignment Length: | 197 | Identity: | 48/197 - (24%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 48/197 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 DDPKRKE--FLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIK 354
Fly 355 GLHLPSSITSAAFTLRTQYMKYLYP----YECEK------------KNLSTPA------------ 391
Fly 392 --ELQAAIDGNRREG----RRSSYGQYEAMHNQMPMTPISRPSLPGGMQQMSPLALVTHAAVANN 450
Fly 451 QQ 452 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
retn | NP_788434.1 | BRIGHT | 294..386 | CDD:128777 | 31/109 (28%) |
AT3G13350 | NP_566454.1 | ARID_HMGB9-like | 42..127 | CDD:350636 | 27/85 (32%) |
HMGB-UBF_HMG-box | 238..301 | CDD:238686 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I3936 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2744 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001099 | |
OrthoInspector | 1 | 1.000 | - | - | otm2864 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.810 |