DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and AT3G13350

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_566454.1 Gene:AT3G13350 / 820535 AraportID:AT3G13350 Length:319 Species:Arabidopsis thaliana


Alignment Length:197 Identity:48/197 - (24%)
Similarity:83/197 - (42%) Gaps:48/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 DDPKRKE--FLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIK 354
            ||..|..  |.:.|.:|:......: ::|.:..:.|||:.|:..|.:|||:..|:..:.|:|:|.
plant    37 DDLVRNSALFWEKLRAFLGLTSKTL-KVPTVGGNTLDLHRLFIEVTSRGGIERVVKDRKWKEVIG 100

  Fly   355 GLHLPSSITSAAFTLRTQYMKYLYP----YECEK------------KNLSTPA------------ 391
            ....|::||||:|.||..|:|:|:.    |..||            |:|:..:            
plant   101 AFSFPTTITSASFVLRKYYLKFLFQLEHVYYLEKPVSSLQSTDEALKSLANESPNPEEGIDEPQV 165

  Fly   392 --ELQAAIDGNRREG----RRSSYGQYEAMHNQMPMTPISRPSLPGGMQQMSPLALVTHAAVANN 450
              |:|..|||....|    .:....:.:.:...:|.||           ..|...:.|.:|:..:
plant   166 GYEVQGFIDGKFDSGYLVTMKLGSQELKGVLYHIPQTP-----------SQSQQTMETPSAIVQS 219

  Fly   451 QQ 452
            .|
plant   220 SQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777 31/109 (28%)
AT3G13350NP_566454.1 ARID_HMGB9-like 42..127 CDD:350636 27/85 (32%)
HMGB-UBF_HMG-box 238..301 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001099
OrthoInspector 1 1.000 - - otm2864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.