DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retn and CG42337

DIOPT Version :9

Sequence 1:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster


Alignment Length:449 Identity:97/449 - (21%)
Similarity:133/449 - (29%) Gaps:186/449 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 SSYGQYEAMHNQMPMTPISR--PSLP---------------GGMQQMSPLA-LVTHAAVANNQQA 453
            |.|.|:.:.|:...:||...  |..|               |.....|.:. ...:|..|:...:
  Fly     8 SFYDQHHSHHHPQHLTPTMSHYPPQPYRSGYTGYHTYGYGYGSSSSASYMPNYYRYAPYASPHYS 72

  Fly   454 QAAAAAAAAHHRLMGAPAFGQMPNLVKQEIESRMMEYLQLIQAKKEQGMPPVLGGNHPHQQQHSQ 518
            |        ||:.|..|| ||      |.|.|.::.|            ||   ..||:||...|
  Fly    73 Q--------HHQGMFTPA-GQ------QIIPSSVLHY------------PP---RPHPYQQLPQQ 107

  Fly   519 QQ---QQQQ------------------------------HH------------------------ 526
            ||   ||.|                              |:                        
  Fly   108 QQPHPQQSQPGYEPPPPLPYSSSASYQSRGFGAFAGPTPHYAPPGRSSTPAPNRTVLPPSYLEPL 172

  Fly   527 --HQQQQQQQSQQQHHLQQQRQRSQSPDLSKHEALSAQVALWHMYHNNNSPPGSAHTSPQQREAL 589
              :..:||..|||||..|||.|....|...|.|....:|.             :...||.||   
  Fly   173 RSYSAEQQHLSQQQHLSQQQLQHHPLPGTPKLEDPDVEVE-------------AVAESPAQR--- 221

  Fly   590 NLSDSPPNLTNIKREREREPTPEPVDQDDKFVDQPPPAKRVGSGLLPPGFPANFYLNPHNMAAVA 654
             |:.|||.::              ....|..:.......|..|....|.:...:   |.||:..:
  Fly   222 -LTTSPPMIS--------------ATGTDSGISNCSTRARSDSSQSTPVYSGEY---PVNMSVES 268

  Fly   655 AA-AGFHHPSMGHQQDAASEGEPEDDYAHGEHNTTGNSSSMHDDSEPQQMNGHHHHQTHHLDKSD 718
            |: ..:|.|:     ||.       ||...||.....:.....|:.              ||.:|
  Fly   269 ASCVPYHCPA-----DAR-------DYEEEEHQPPVTAEVRRADTP--------------LDITD 307

  Fly   719 D-------SAIENSPTTSTTTGGSVGHRHSSPVSTKKKGGAKPQSGGK-DVPTEDKDAS 769
            |       :|.|..||..|          ||.|:...:...:|.|... ||||..:|.|
  Fly   308 DISATSPVAADEVKPTAPT----------SSQVAKSAETNLQPDSAASLDVPTTPQDTS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retnNP_788434.1 BRIGHT 294..386 CDD:128777
CG42337NP_001246858.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.