DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and YPK2

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_013822.1 Gene:YPK2 / 855130 SGDID:S000004710 Length:677 Species:Saccharomyces cerevisiae


Alignment Length:474 Identity:133/474 - (28%)
Similarity:209/474 - (44%) Gaps:109/474 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TQSHPPGDEEQPVQSQQQQLSTWS---------------LGSLSGGRLNWSFSGARNSFRHRNKA 119
            |.|...|..||||.:   ::||:.               :.||.....||     :.....:::.
Yeast   219 TISPDMGTMEQPVFN---KISTFDVTRKLRFLKIDVFARIPSLLLPSKNW-----QQEIGEQDEV 275

  Fly   120 TRKSLTSLHGSRR-GKTQWHRPLTNSI--------FNSHF---------------KETSKNDLYR 160
            .::.|..::.::. ....:|.||...|        :|.|:               .:.|||....
Yeast   276 LKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLS 340

  Fly   161 ID-----HLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSV-RQIKDEADIQKV-CGHH 218
            ||     .::.||:||.|.:| .|.|..:.||||.|:|:.::....| ..:.:...:.:| |   
Yeast   341 IDDFDLLKVIGKGSFGKVMQV-RKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC--- 401

  Fly   219 PFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLHNAGIIYR 280
            ||||.....:|:...|:::..::..||||..:.|   ||:...|.||.|:..|||.||...:|||
Yeast   402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYR 466

  Fly   281 DAKPENILLTEQFHIKLTDFGLSKW-LKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVI 344
            |.|||||||..|.||.|.||||.|. :|....|.|.|||.:|:|||||.|:.|...||||.||::
Yeast   467 DLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGIL 531

  Fly   345 ACQMLTQKSPNIKRH--LLRRRESVEP---EDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHL 404
            ..:|:|...|....:  ::.::...:|   .||...|                            
Yeast   532 LYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA---------------------------- 568

  Fly   405 THEGRDVLRKLLTIEPRQR--IRSVMALQRIAIYKDYNLSSKQLL---SLSPREIIARDGIRIYE 464
               .:|:|..||:.:|.:|  :.....::....:||  :|.|:||   .:.|.:.|.:..|   :
Yeast   569 ---AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD--ISWKKLLLKGYIPPYKPIVKSEI---D 625

  Fly   465 DRHFDQ-LTNQCAIDAFLD 482
            ..:||| .|.:..||:.:|
Yeast   626 TANFDQEFTKEKPIDSVVD 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 94/289 (33%)
STKc_AGC 167..>354 CDD:270693 81/192 (42%)
YPK2NP_013822.1 YPK1_N_like 114..339 CDD:212165 23/127 (18%)
PKc_like 349..660 CDD:419665 108/336 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.