DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and Prkcq

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001263650.1 Gene:Prkcq / 85420 RGDID:620968 Length:707 Species:Rattus norvegicus


Alignment Length:365 Identity:109/365 - (29%)
Similarity:157/365 - (43%) Gaps:73/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 WHRPLTNSIFNSHFKETSKN------------DLYRIDHLVAKGAFGVVFKVSSKSDISQCYALK 189
            |..||..:...:...|...|            |.:.:..::.||:||.||....|. ..|.:|:|
  Rat   346 WESPLDGADKTAQPPEPEVNLQRASLQLKLKIDDFILHKMLGKGSFGKVFLAEFKR-TKQFFAIK 409

  Fly   190 VLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKIT--- 251
            .|||..::.|:.|.....|..:..:...|||:......:|.:.||..:.||:..|:|...|.   
  Rat   410 ALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCH 474

  Fly   252 HFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLG-ANTRTM 315
            .|.:.....|..||.|.|.|||:.||:|||.|.:||||....|||:.|||:.|...|| |.|.|.
  Rat   475 KFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTF 539

  Fly   316 CGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIA 380
            |||..|:|||||.|:.|.|:||||:.||:..:||..:||            ...:|......||.
  Rat   540 CGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSP------------FHGQDEEELFHSIR 592

  Fly   381 QINGCLQDSDGDSEDFLPEEVQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYN----- 440
            ..|           .|.|   :.|..|.:|:|.||...||.:|:.....:::..::::.|     
  Rat   593 MDN-----------PFYP---RWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELE 643

  Fly   441 -------------------------LSSKQLLSLSPREII 455
                                     ||.|..||.:.|.:|
  Rat   644 RKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/275 (35%)
STKc_AGC 167..>354 CDD:270693 78/190 (41%)
PrkcqNP_001263650.1 C1_1 160..212 CDD:278556
C1_1 232..284 CDD:278556
STKc_nPKC_theta 374..704 CDD:270770 104/337 (31%)
S_TKc 380..634 CDD:214567 95/280 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.