DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and YPK1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_012796.1 Gene:YPK1 / 853733 SGDID:S000001609 Length:680 Species:Saccharomyces cerevisiae


Alignment Length:405 Identity:120/405 - (29%)
Similarity:182/405 - (44%) Gaps:82/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LNWSFSGARN--SFRHRNKATRKSLTSLHGSRRGKTQWHRPLTNSIFNSHFKETSKNDLYRIDHL 164
            :|.||..|.:  .:.|........|..::.|...|...::||:...|          ||.::   
Yeast   301 INLSFDSAASIRLYNHHWITLDNGLGKINISIDYKPSRNKPLSIDDF----------DLLKV--- 352

  Fly   165 VAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSV-RQIKDEADIQKV-CGHHPFIVKQIDL 227
            :.||:||.|.:| .|.|..:.||||.::||.::..:.| ..:.:...:.:| |   ||||.....
Yeast   353 IGKGSFGKVMQV-RKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDC---PFIVPLKFS 413

  Fly   228 WQNRHNLHILSEYVPNGELF---SKITHFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILL 289
            :|:...|:.:..::..||||   .|...|.:...|.|..|:..|||.||...::|||.|||||||
Yeast   414 FQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILL 478

  Fly   290 TEQFHIKLTDFGLSKW-LKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLT--- 350
            ..|.||.|.||||.|. :|....|.|.|||.:|:|||:|.|..|..|||||.|||:..:|||   
Yeast   479 DYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLP 543

  Fly   351 ----QKSPNIKRHLLRRRESVEP---EDGLSNAPSIAQINGCLQDSDGDSEDFL-----PEEVQH 403
                :..|.:.:.:|:     ||   .||.                |.|::|.|     .:..:.
Yeast   544 PYYDEDVPKMYKKILQ-----EPLVFPDGF----------------DRDAKDLLIGLLSRDPTRR 587

  Fly   404 LTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLSPREIIARDGIRIYEDRHF 468
            |.:.|.|.:|       .....|.::.:|: :.|.|....|..:|.|            .:..:|
Yeast   588 LGYNGADEIR-------NHPFFSQLSWKRL-LMKGYIPPYKPAVSNS------------MDTSNF 632

  Fly   469 D-QLTNQCAIDAFLD 482
            | :.|.:..||:.:|
Yeast   633 DEEFTREKPIDSVVD 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/292 (33%)
STKc_AGC 167..>354 CDD:270693 80/199 (40%)
YPK1NP_012796.1 YPK1_N_like 116..342 CDD:212165 8/40 (20%)
PKc_like 352..663 CDD:419665 107/344 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.