DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and YPK3

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_009584.1 Gene:YPK3 / 852316 SGDID:S000000232 Length:525 Species:Saccharomyces cerevisiae


Alignment Length:371 Identity:112/371 - (30%)
Similarity:167/371 - (45%) Gaps:94/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RHRNKATRK--SLT-------SLHGSRRGKTQWHR-PLT-NSIFNSHFKETSKNDLYRIDH---- 163
            |.|:.|..|  .||       |:.||...:|..:| .:| ..|.:|:..|   |:|.|..|    
Yeast    69 RRRSSAYSKFPILTPPNTRRFSITGSDAMRTNTNRLSITPQDIISSNIGE---NELSRNLHDFKP 130

  Fly   164 --LVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLI----EDNSVRQIKDEAD------------ 210
              ::.:||:|.|..|.. .:.|:.||:|.|:|::::    ..:|.|:.:|:.|            
Yeast   131 VRVLGQGAYGKVLLVKD-VNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDGNNNDNDDGLSK 194

  Fly   211 -----------IQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKI-THFSID--LVRLY 261
                       :.::  .||.|||....:.:...|::|.:|:|.||||..: .|.::|  .|..|
Yeast   195 RLERTFAERSILSEI--EHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETTVSFY 257

  Fly   262 IGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLGANTR------------- 313
            ..||:.||.|||..|::|||.||||.||.::.|:.|||||||   |..||..             
Yeast   258 AAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLS---KKSANDSAVDEEDPENVNAL 319

  Fly   314 -TMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAP 377
             ::.||.:|.|||||.|:.|....||::||.:...||..|.|...                ||..
Yeast   320 YSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG----------------SNHK 368

  Fly   378 SIAQINGCLQDSDGDSEDFLPEEVQHLTHEGRDVLRKLLTIEPRQR 423
            .|  ||...|:..|....|      :|:...:|:|..||..|..:|
Yeast   369 VI--INKIQQNKQGPKIPF------YLSEGMKDILNALLKKETAKR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/315 (30%)
STKc_AGC 167..>354 CDD:270693 77/230 (33%)
YPK3NP_009584.1 STKc_AGC 134..406 CDD:270693 92/301 (31%)
S_TK_X 445..516 CDD:214529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.