DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and PK1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001326081.1 Gene:PK1 / 820020 AraportID:AT3G08730 Length:465 Species:Arabidopsis thaliana


Alignment Length:335 Identity:107/335 - (31%)
Similarity:178/335 - (53%) Gaps:47/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI-QKVCGHHPF 220
            |.:.:..:|.|||||.|::| .|.:.|:.||:||::|..::|.|....:|.|.|| .|:  .|||
plant   132 DDFEVMKVVGKGAFGKVYQV-RKKETSEIYAMKVMRKDHIMEKNHAEYMKAERDILTKI--DHPF 193

  Fly   221 IVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLHNAGIIYRDA 282
            ||:....:|.::.|:::.:::..|.||.::.|   |..||.|:|..||..|:..||..||::||.
plant   194 IVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMHRDL 258

  Fly   283 KPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQ 347
            ||||||:....|:.||||||:|..:....:.:||||.:||||||:.|:.:..|.|||::|::..:
plant   259 KPENILMDTDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGILLYE 323

  Fly   348 MLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGRDVL 412
            |||.|.|.:..                        .|.:|......:..||   |.|::|...:|
plant   324 MLTGKPPFLGS------------------------KGKIQQKIVKDKIKLP---QFLSNEAHAIL 361

  Fly   413 RKLLTIEPRQRIRSVMA----LQRIAIYKDYN---LSSKQLLSLSPREIIARDGIRIYEDRHFDQ 470
            :.||..||.:|:.|.::    :::...:|..|   |.:::::.....|:..|..|     .:||:
plant   362 KGLLQKEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCI-----ANFDK 421

  Fly   471 L-TNQCAIDA 479
            . |:...:|:
plant   422 CWTDMSVLDS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 96/279 (34%)
STKc_AGC 167..>354 CDD:270693 80/190 (42%)
PK1NP_001326081.1 STKc_AGC 140..389 CDD:270693 96/278 (35%)
S_TK_X 390..452 CDD:214529 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.