DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and si:ch211-195b13.1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001070770.2 Gene:si:ch211-195b13.1 / 768159 ZFINID:ZDB-GENE-030131-7626 Length:423 Species:Danio rerio


Alignment Length:322 Identity:99/322 - (30%)
Similarity:149/322 - (46%) Gaps:54/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLW 228
            ::.||:||.|.....|.: ...||:|||:|..:::....:.|..|..:......|||:|.....:
Zfish    96 IIGKGSFGKVLLARHKEN-ELYYAVKVLQKKIIMKKKEQKHIMAERSVLMKNIKHPFLVGLHYSF 159

  Fly   229 QNRHNLHILSEYVPNGELFSKITHFSIDL---VRLYIGEIALALDFLHNAGIIYRDAKPENILLT 290
            |....|:.:.:||..||||..:....:.|   .|.|..|||.||.:||:..|:|||.|||||||.
Zfish   160 QTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLD 224

  Fly   291 EQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSP 354
            .|.||.||||||.| .|.....|.|.|||.:|:|||:|..:.|...||||.||.:..:||....|
Zfish   225 SQGHIVLTDFGLCKEGLDPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLFEMLYGLPP 289

  Fly   355 NIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGRDVLRKLLTIE 419
                  ...|.:.|..:.:.:.|.:.:.|                    :::.|||:|..||..:
Zfish   290 ------FYSRNTAEMYNNILHKPLVLKPN--------------------VSNAGRDLLEGLLHKD 328

  Fly   420 PRQRIRS---VMALQRIAIYKDYN---LSSKQLLS------LSPREIIARDGIRIYEDRHFD 469
            ..:|:.|   .:.|:..:.:...|   |.:|:::.      ..|.::           ||||
Zfish   329 RTKRLGSKDDFLELKFHSFFSPINWDDLMAKRIVPPFIPTVTGPTDL-----------RHFD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 90/273 (33%)
STKc_AGC 167..>354 CDD:270693 77/190 (41%)
si:ch211-195b13.1NP_001070770.2 S_TKc 91..348 CDD:214567 91/278 (33%)
STKc_SGK 95..415 CDD:270727 99/322 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.