DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and SGK1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens


Alignment Length:282 Identity:92/282 - (32%)
Similarity:135/282 - (47%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.:.    :....::.||:||.|.....|:: ...||:|||:|..:::....:.|..|.::
Human   185 NPHAKPSD----FHFLKVIGKGSFGKVLLARHKAE-EVFYAVKVLQKKAILKKKEEKHIMSERNV 244

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.:|:..||||..:..   |.....|.|..|||.||.:||
Human   245 LLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLH 309

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSKW-LKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||..|.||.||||||.|. ::..:.|.|.|||.:|:|||:|..:||...||
Human   310 SLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVD 374

  Fly   338 WWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQ 402
            ||.||.:..:||....|      ...|.:.|..|.:.|.|...:.|                   
Human   375 WWCLGAVLYEMLYGLPP------FYSRNTAEMYDNILNKPLQLKPN------------------- 414

  Fly   403 HLTHEGRDVLRKLLTIEPRQRI 424
             :|:..|.:|..||..:..:|:
Human   415 -ITNSARHLLEGLLQKDRTKRL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 89/270 (33%)
STKc_AGC 167..>354 CDD:270693 76/190 (40%)
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 89/270 (33%)
STKc_SGK 197..519 CDD:270727 89/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.