DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and sgk1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_012818527.1 Gene:sgk1 / 594981 XenbaseID:XB-GENE-1003518 Length:434 Species:Xenopus tropicalis


Alignment Length:309 Identity:99/309 - (32%)
Similarity:146/309 - (47%) Gaps:45/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.:.    ::...::.||:||.|......:| .:.||:|||:|..:::....:.|..|.::
 Frog    93 NPHAKPSD----FQFLKIIGKGSFGKVLLARHNAD-EKFYAVKVLQKKAILKKKEEKHIMSERNV 152

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.:|:..||||..:..   |.....|.|..|||.||.:||
 Frog   153 LLKNVKHPFLVGLHFSFQTTSRLYFILDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLH 217

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSKW-LKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||..|.||.||||||.|. ::....|.|.|||.:|:|||:|..:||...||
 Frog   218 SLNIVYRDLKPENILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVD 282

  Fly   338 WWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQ 402
            ||.||.:..:||....|      ...|.:.|..|.:.|.|...:.|                   
 Frog   283 WWCLGAVLYEMLYGLPP------FYSRNTAEMYDNILNKPLQLKPN------------------- 322

  Fly   403 HLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLSP 451
             :|:..|::|..||     |:.|:    :||....|: :..|..:..||
 Frog   323 -ITNSARNLLEGLL-----QKDRT----KRIGAKNDF-MEIKNHMFFSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 90/275 (33%)
STKc_AGC 167..>354 CDD:270693 76/190 (40%)
sgk1XP_012818527.1 STKc_SGK1 93..431 CDD:270753 99/309 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.