DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and sgk2a

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001107094.1 Gene:sgk2a / 570956 ZFINID:ZDB-GENE-030131-9632 Length:361 Species:Danio rerio


Alignment Length:303 Identity:103/303 - (33%)
Similarity:147/303 - (48%) Gaps:23/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.|..:.|    .::.||.||.|.....|:| .:.||:|||:|..:::....:.|..|.::
Zfish    22 NPHAKPTDFDFL----AVIGKGTFGKVLLAKLKAD-GKFYAVKVLQKKVILKKKEQKNIMAERNV 81

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.:||..||||..:..   ||....|.|..|:|.|:.:||
Zfish    82 LLKSLKHPFLVGLHYSFQTSEKLYFVLDYVNGGELFYHLQRERCFSEPRARFYTAEVASAIGYLH 146

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||..|.|:.||||||.| .::....|.|.|||.:|:|||:|..|||...||
Zfish   147 SLNIVYRDLKPENILLDYQGHVVLTDFGLCKEGIEPEGTTTTFCGTPEYLAPEVLRKEPYDRTVD 211

  Fly   338 WWALGVIACQMLTQKSPNIKRHLLRRRESV--EP---EDGLSNAPSIAQINGCLQDSD----GDS 393
            ||.||.:..:||....|...|.:....:::  :|   ..|.|.:..:. :.|.||...    |..
Zfish   212 WWCLGAVLHEMLYSLPPFYSRDVSEMYDAILHKPLHLPPGKSESACLL-LYGLLQKDQHRRTGAI 275

  Fly   394 EDFLPEEVQHLTH---EGRDVLRKLLTIEPRQRIRSVMALQRI 433
            .||| |...|:..   ...|:..|.:|......:|....||.|
Zfish   276 ADFL-EIKNHVFFAPINWDDLYHKRITPPYNPNVRGPADLQHI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/287 (33%)
STKc_AGC 167..>354 CDD:270693 77/190 (41%)
sgk2aNP_001107094.1 S_TKc 30..287 CDD:214567 92/263 (35%)
STKc_SGK2 34..355 CDD:270754 98/287 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.