DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and sgk3

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001103937.1 Gene:sgk3 / 564523 ZFINID:ZDB-GENE-070424-62 Length:486 Species:Danio rerio


Alignment Length:278 Identity:102/278 - (36%)
Similarity:140/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.|..:.|    .::.||:||.|.....|.| .:|||:|||:|..::.....:.|..|.::
Zfish   144 NPHAKPTDFDFL----KVIGKGSFGKVLLAKRKRD-GKCYAIKVLQKKVILNRREQKHIMAERNV 203

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELF---SKITHFSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.::|..||||   .|...|.....:.||.|:|.||.:||
Zfish   204 LLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFFHLQKERTFPEPRAKFYIAEMASALGYLH 268

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||..|.||.||||||.| .:.....|.|.|||.:|:|||:|..:||.:.||
Zfish   269 SLNIVYRDLKPENILLDSQGHIVLTDFGLCKEGISQADTTTTFCGTPEYLAPEVLRKQPYDNTVD 333

  Fly   338 WWALGVIACQMLTQKSPNIKR-------HLLRRRESVEPEDGLSNAP-SIAQINGCLQDSD---- 390
            ||.||.:..:||....|...|       ::|.:...:.|  |.|.|. ||.|   .|.:.|    
Zfish   334 WWCLGSVLYEMLYGLPPFYSRDTHEMYDNILHKELVMRP--GASTAAWSILQ---TLLEKDHTRR 393

  Fly   391 -GDSEDFLPEEVQHLTHE 407
             |..:||  .||:.  ||
Zfish   394 LGYRDDF--NEVKE--HE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 97/266 (36%)
STKc_AGC 167..>354 CDD:270693 78/190 (41%)
sgk3NP_001103937.1 PX_CISK 6..114 CDD:132780
S_TKc 152..409 CDD:214567 98/270 (36%)
STKc_SGK3 155..480 CDD:270755 98/267 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.