DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and PRKCQ

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005252553.1 Gene:PRKCQ / 5588 HGNCID:9410 Length:740 Species:Homo sapiens


Alignment Length:331 Identity:103/331 - (31%)
Similarity:152/331 - (45%) Gaps:43/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 WHRPLTNSIFNSHFKETSKN------------DLYRIDHLVAKGAFGVVFKVSSKSDISQCYALK 189
            |..||.......|..|...|            :.:.:..::.||:||.||....|. .:|.:|:|
Human   380 WESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKK-TNQFFAIK 443

  Fly   190 VLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKIT--- 251
            .|||..::.|:.|.....|..:..:...|||:......:|.:.||..:.||:..|:|...|.   
Human   444 ALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCH 508

  Fly   252 HFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLG-ANTRTM 315
            .|.:.....|..||.|.|.|||:.||:|||.|.:||||.:..|||:.|||:.|...|| |.|.|.
Human   509 KFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTF 573

  Fly   316 CGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIA 380
            |||..|:|||||.|:.|.|:||||:.||:..:||..:||            ...:|......||.
Human   574 CGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSP------------FHGQDEEELFHSIR 626

  Fly   381 QINGCLQDSDGDSEDFLPEEVQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQ 445
            ..|           .|.|   :.|..|.:|:|.||...||.:|:.....:::..::::.|....:
Human   627 MDN-----------PFYP---RWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELE 677

  Fly   446 LLSLSP 451
            ...:.|
Human   678 RKEIDP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/275 (35%)
STKc_AGC 167..>354 CDD:270693 78/190 (41%)
PRKCQXP_005252553.1 C1_1 194..246 CDD:278556
C1_1 266..318 CDD:278556
STKc_nPKC_theta 408..738 CDD:270770 97/303 (32%)
S_TKc 414..668 CDD:214567 95/280 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.