DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and rps6kb1b

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_998241.1 Gene:rps6kb1b / 406349 ZFINID:ZDB-GENE-040426-2038 Length:502 Species:Danio rerio


Alignment Length:347 Identity:114/347 - (32%)
Similarity:169/347 - (48%) Gaps:55/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ETSKNDLYRIDHLVAKGAFGVVFKVSSKSDIS--QCYALKVLKKSKLIEDNSVRQIKDEAD---- 210
            |..:.:.:.:..::.||.:|.||:|...|..:  :.:|:|||||:.:     ||..||.|.    
Zfish    58 ENIRPECFELLRVLGKGGYGKVFQVRKVSGAATGKIFAMKVLKKAMI-----VRNAKDTAHTKAE 117

  Fly   211 ---IQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALAL 269
               :::|  .|||||..|..:|....|:::.||:..||||.::..   |..|....|:.||::||
Zfish   118 RNILEEV--KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMAL 180

  Fly   270 DFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYG 333
            ..||..||||||.|||||:|..|.|:|||||||.| .:..|..|.|.|||.:|||||||....:.
Zfish   181 GHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHN 245

  Fly   334 HAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLP 398
            .|||||:||.:...|||               ...|..|.:...:|.:|..|..:        ||
Zfish   246 RAVDWWSLGALMYDMLT---------------GAPPFTGENRKKTIDKILKCKLN--------LP 287

  Fly   399 EEVQHLTHEGRDVLRKLLTIEPRQRIRS----VMALQRIAIYKDYNLSSKQLLSLSPREIIARDG 459
               .:||.|.||:|::||......|:.:    ...:|....::..|........:.|.   .:..
Zfish   288 ---PYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHVNWDDLLARKVEPP---FKPF 346

  Fly   460 IRIYED-RHFD-QLTNQCAIDA 479
            ::..|| ..|| :.|:|..:|:
Zfish   347 LQFAEDVSQFDSKFTSQTPVDS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 103/288 (36%)
STKc_AGC 167..>354 CDD:270693 87/199 (44%)
rps6kb1bNP_998241.1 S_TKc 65..326 CDD:214567 104/293 (35%)
STKc_p70S6K 68..390 CDD:270736 113/337 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.