DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and CG32944

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster


Alignment Length:309 Identity:87/309 - (28%)
Similarity:143/309 - (46%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKVCGHHPFI 221
            |.::|...:.||:||.|. :..|.|....||:|.:.:|......::..:..|.::.... .|||:
  Fly   149 DHFQILRAIGKGSFGKVC-IVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVELLSSL-EHPFL 211

  Fly   222 VKQIDLW---QNRHNLHILSEYVPNGEL---FSKITHFSIDLVRLYIGEIALALDFLHNAGIIYR 280
            |   :||   |:..:|.::.:.:..|:|   ......||...|.|.:.|:..||::|....:::|
  Fly   212 V---NLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVVHR 273

  Fly   281 DAKPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEI-LCG----EPYGHAVDWWA 340
            |.||:||||.:..|..||||.::..|:..|...:|.||..|||||: ||.    ..|.:.||||:
  Fly   274 DIKPDNILLDDAGHAHLTDFNIATRLQKNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWS 338

  Fly   341 LGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLT 405
            |||:|.:|               |.::.|....||.| :|:|...|...               .
  Fly   339 LGVVAYEM---------------RGNIRPFVVHSNTP-LAEIKNILNTP---------------V 372

  Fly   406 HEGR-------DVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLL 447
            |..|       |:|::||:..|..||.:...|.:..:.:  |:..:::|
  Fly   373 HYPRYWSSNFVDLLQRLLSTYPGARISTRQELHQTPMLR--NIDFQRVL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 83/289 (29%)
STKc_AGC 167..>354 CDD:270693 65/197 (33%)
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 84/295 (28%)
S_TKc 151..405 CDD:214567 83/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.