DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and Rps6kb2

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001010962.2 Gene:Rps6kb2 / 361696 RGDID:1305144 Length:485 Species:Rattus norvegicus


Alignment Length:355 Identity:116/355 - (32%)
Similarity:164/355 - (46%) Gaps:74/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LVAKGAFGVVFKVS--SKSDISQCYALKVLKKSKLI-----------EDNSVRQIKDEADIQKVC 215
            ::.||.:|.||:|.  ..:::.:.||:|||:|:|::           |.|.:..:|         
  Rat    72 VLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVK--------- 127

  Fly   216 GHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLHNAGI 277
              |||||:....:|....|:::.|.:..||||:.:..   |..|....|:.||.|||..||:.||
  Rat   128 --HPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGI 190

  Fly   278 IYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWAL 341
            ||||.|||||:|..|.|||||||||.| .:..||.|.|.|||.:|||||||....:..|||||:|
  Rat   191 IYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRIGHNRAVDWWSL 255

  Fly   342 GVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTH 406
            |.:...|||...|....:..:..:.:              |.|.|         .||   .:||.
  Rat   256 GALMYDMLTGSPPFTAENRKKTMDKI--------------IKGKL---------VLP---PYLTP 294

  Fly   407 EGRDVLRKLLTIEPRQRI----RSVMALQRIAIYKDYNLSSKQLL----------SLSPREIIAR 457
            :.||:.:|.|...|..||    .....:||...::..|..  .||          ||...|.:::
  Rat   295 DARDLAKKFLKRNPTHRIGGGPGDAADVQRHPFFRHINWD--DLLAHRVDPPFRPSLQSEEDVSQ 357

  Fly   458 DGIRIYE----DRHFDQLTNQCAIDAFLDF 483
            ..:|...    |...|...::.|..|||.|
  Rat   358 FDVRFTRQTPVDSPDDTALSESANQAFLGF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 100/287 (35%)
STKc_AGC 167..>354 CDD:270693 85/203 (42%)
Rps6kb2NP_001010962.2 STKc_p70S6K 70..392 CDD:270736 116/355 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.