DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and Stk32b

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001100694.1 Gene:Stk32b / 305431 RGDID:1306173 Length:414 Species:Rattus norvegicus


Alignment Length:386 Identity:114/386 - (29%)
Similarity:179/386 - (46%) Gaps:73/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GKTQWHRPLTNSIFNSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLI 197
            |....|:|   .:|:.:  |....|.::|...:.||:||.|. :..|.|..:.||:|.:.|.|.:
  Rat     2 GGNHSHKP---PVFDEN--EEVNFDHFQILRAIGKGSFGKVC-IVQKRDTKKMYAMKYMNKQKCV 60

  Fly   198 EDNSVRQIKDEADIQKVCGHHPFIVKQIDLW---QNRHNLHILSEYVPNGEL---FSKITHFSID 256
            |.:.||.:..|..|.:.. .|||:|   :||   |:..::.::.:.:..|:|   ..:..||:..
  Rat    61 ERDEVRNVFRELQIMQGL-EHPFLV---NLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEG 121

  Fly   257 LVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKY 321
            .|:||:.|:||||::|....||:||.||:||||.|..|:.:|||.::..||......:|.||..|
  Rat   122 AVKLYVCELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVLKGTEKASSMAGTKPY 186

  Fly   322 MAPEIL-----CGEPYGHAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQ 381
            |||||.     .|..|.:.||||:|||.|.::|....| .:.|      |..|.|.:.|.     
  Rat   187 MAPEIFQVYVDGGPGYSYPVDWWSLGVTAYELLRGWRP-YEIH------SATPVDEILNM----- 239

  Fly   382 INGCLQDSDGDSEDFLPEEVQHLTH--EGR-DVLRKLLTIEPRQRIRSVMALQRIAIYKDYN--- 440
                          |..|.|.:.:.  ||. |:|:||||.:|..|:.|:..:|.:....|.|   
  Rat   240 --------------FKVERVHYSSTWCEGMVDLLKKLLTKDPEIRLSSLRDIQSMTYLADMNWDA 290

  Fly   441 ----------LSSKQLLSLSP----REIIA------RDGIRIYEDRHFDQLTNQCAIDAFL 481
                      :.:|..|:..|    .|:|.      :...|:.:.|..|...:.|.::..|
  Rat   291 VFNKALMPGFVPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKHRSRDSTKDSCPLNGHL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 95/285 (33%)
STKc_AGC 167..>354 CDD:270693 74/197 (38%)
Stk32bNP_001100694.1 STKc_Yank1 22..283 CDD:270730 96/291 (33%)
S_TKc 23..272 CDD:214567 94/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.