DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and gad8

DIOPT Version :10

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_588010.1 Gene:gad8 / 2539206 PomBaseID:SPCC24B10.07 Length:569 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:92/276 - (33%)
Similarity:138/276 - (50%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSV-RQIKDEADIQKVCGHHPF 220
            |.:.:..:|.||:||.|.:| .|.|.|:.||||.:||:.::..:.| ..:.:...:.:|  ::||
pombe   228 DAFELLKVVGKGSFGKVMQV-RKRDTSRIYALKTMKKAHIVSRSEVDHTLAERTVLAQV--NNPF 289

  Fly   221 IVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLHNAGIIYRDA 282
            ||.....:|:...|:::..:|..||||..:..   |.....:.||.|:.:||:.||...:||||.
pombe   290 IVPLKFSFQSPGKLYLVLAFVNGGELFHHLQREGCFDTYRAKFYIAELLVALECLHEFNVIYRDL 354

  Fly   283 KPENILLTEQFHIKLTDFGLSKWLKLGA--NTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIA 345
            |||||||....||.|.||||.| |.:..  .|.|.|||.:|:|||:|.|..|...||||.|||:.
pombe   355 KPENILLDYTGHIALCDFGLCK-LNMAKTDRTNTFCGTPEYLAPELLLGHGYTKVVDWWTLGVLL 418

  Fly   346 CQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGRD 410
            .:|:|...|....::......:                  |||...     .|:.:.   .:.:|
pombe   419 YEMITGLPPFYDENINEMYRKI------------------LQDPLR-----FPDNID---EKAKD 457

  Fly   411 VLRKLLTIEPRQRIRS 426
            :|..|||..|.:|:.|
pombe   458 LLSGLLTRAPEKRLGS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 STKc_AGC 167..>354 CDD:270693 77/192 (40%)
gad8NP_588010.1 YPK1_N_like 66..225 CDD:212165
STKc_YPK1_like 235..547 CDD:270737 91/269 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.