DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and Sgk1

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001155317.2 Gene:Sgk1 / 20393 MGIID:1340062 Length:524 Species:Mus musculus


Alignment Length:282 Identity:92/282 - (32%)
Similarity:134/282 - (47%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.:.    :....::.||:||.|.....|:: ...||:|||:|..:::....:.|..|.::
Mouse   183 NPHAKPSD----FHFLKVIGKGSFGKVLLARHKAE-EVFYAVKVLQKKAILKKKEEKHIMSERNV 242

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.:|:..||||..:..   |.....|.|..|||.||.:||
Mouse   243 LLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLH 307

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSKW-LKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||..|.||.||||||.|. ::....|.|.|||.:|:|||:|..:||...||
Mouse   308 SLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVD 372

  Fly   338 WWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQ 402
            ||.||.:..:||....|      ...|.:.|..|.:.|.|...:.|                   
Mouse   373 WWCLGAVLYEMLYGLPP------FYSRNTAEMYDNILNKPLQLKPN------------------- 412

  Fly   403 HLTHEGRDVLRKLLTIEPRQRI 424
             :|:..|.:|..||..:..:|:
Mouse   413 -ITNSARHLLEGLLQKDRTKRL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 89/270 (33%)
STKc_AGC 167..>354 CDD:270693 76/190 (40%)
Sgk1NP_001155317.2 STKc_SGK1 183..521 CDD:270753 92/282 (33%)
S_TKc 191..448 CDD:214567 89/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.