DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and STK32A

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001274669.1 Gene:STK32A / 202374 HGNCID:28317 Length:407 Species:Homo sapiens


Alignment Length:301 Identity:96/301 - (31%)
Similarity:143/301 - (47%) Gaps:44/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 KNDLYRIDHL-----VAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKV 214
            :|:....||.     :.||:||.|. :..|:|..:.||:|.:.|.|.:|.|.||.:..|..|.:.
Human    14 ENEDVNFDHFEILRAIGKGSFGKVC-IVQKNDTKKMYAMKYMNKQKCVERNEVRNVFKELQIMQG 77

  Fly   215 CGHHPFIVKQIDLW---QNRHNLHILSEYVPNGEL---FSKITHFSIDLVRLYIGEIALALDFLH 273
            . .|||:|   :||   |:..::.::.:.:..|:|   ..:..||..:.|:|:|.|:.:|||:|.
Human    78 L-EHPFLV---NLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQ 138

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEILC---GEPYGHA 335
            |..||:||.||:||||.|..|:.:|||.::..|.......||.||..|||||:..   |..|..|
Human   139 NQRIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTMAGTKPYMAPEMFSSRKGAGYSFA 203

  Fly   336 VDWWALGVIACQMLTQKSPNIKRHLLRRRESVEP-EDGLSNAPSIAQINGCLQDSDGDSEDFLPE 399
            ||||:|||.|.::|..:.|...|.....:|.|.. |..:...||.                    
Human   204 VDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSA-------------------- 248

  Fly   400 EVQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYN 440
                .:.|...:|:|||...|.||...:..:|......|.|
Human   249 ----WSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 92/286 (32%)
STKc_AGC 167..>354 CDD:270693 75/195 (38%)
STK32ANP_001274669.1 STKc_Yank1 22..281 CDD:270730 92/287 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.