DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and Sgk2

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_604458.1 Gene:Sgk2 / 171497 RGDID:620232 Length:367 Species:Rattus norvegicus


Alignment Length:320 Identity:102/320 - (31%)
Similarity:146/320 - (45%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLW 228
            ::.||.:|.|.....||| ...||:|||:|..::::.....|..|.::......|||:|.....:
  Rat    40 VIGKGNYGKVLLAKRKSD-GAFYAVKVLQKKSILKNKEQSHIMAERNVLLKNVRHPFLVGLRYSF 103

  Fly   229 QNRHNLHILSEYVPNGELFSKIT---HFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLT 290
            |....|:.:.:||..||||..:.   .|.....|.|..|:|.|:.:||:..|||||.|||||||.
  Rat   104 QTPEKLYFVLDYVNGGELFFHLQREHRFLEPRARFYTAEVASAIGYLHSLNIIYRDLKPENILLD 168

  Fly   291 EQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSP 354
            .|.|:.||||||.| .::....|.|.|||.:|:|||:|..|||..|||||.||.:..:||....|
  Rat   169 CQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPP 233

  Fly   355 NIKRHLLRRRESV--EPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGR-----DVL 412
            .....:.:..|::  :|          .||.|                       ||     |:|
  Rat   234 FFNTDVAQMYENILHQP----------LQIPG-----------------------GRTVAACDLL 265

  Fly   413 RKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLSPREIIARDGIRIYEDRHFDQLT 472
            :.||..:.|||:.|          |:..|..|..:..||..         ::|.:..:||
  Rat   266 QGLLHKDQRQRLGS----------KEDFLDIKNHMFFSPIN---------WDDLYHKRLT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 94/277 (34%)
STKc_AGC 167..>354 CDD:270693 78/190 (41%)
Sgk2NP_604458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
S_TKc 35..292 CDD:214567 97/295 (33%)
PKc_like 39..359 CDD:304357 102/320 (32%)
Nuclear localization signal. /evidence=ECO:0000250 68..77 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.