DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and SGK2

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001186193.1 Gene:SGK2 / 10110 HGNCID:13900 Length:367 Species:Homo sapiens


Alignment Length:274 Identity:94/274 - (34%)
Similarity:131/274 - (47%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLW 228
            ::.||.:|.|.....||| ...||:|||:|..:::......|..|..:......|||:|.....:
Human    40 VIGKGNYGKVLLAKRKSD-GAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSF 103

  Fly   229 QNRHNLHILSEYVPNGELF---SKITHFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLT 290
            |....|:.:.:||..||||   .:...|.....|.|..|:|.|:.:||:..|||||.|||||||.
Human   104 QTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLD 168

  Fly   291 EQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSP 354
            .|.|:.||||||.| .::....|.|.|||.:|:|||:|..|||..|||||.||.:..:||....|
Human   169 CQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPP 233

  Fly   355 NIKRHLLRRRESV--EPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGR-----DVL 412
            ...:.:.:..|::  :|          .||.|                       ||     |:|
Human   234 FYSQDVSQMYENILHQP----------LQIPG-----------------------GRTVAACDLL 265

  Fly   413 RKLLTIEPRQRIRS 426
            :.||..:.|||:.|
Human   266 QSLLHKDQRQRLGS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 94/274 (34%)
STKc_AGC 167..>354 CDD:270693 78/190 (41%)
SGK2NP_001186193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_SGK2 39..359 CDD:270754 94/274 (34%)
Nuclear localization signal. /evidence=ECO:0000250 68..78 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.